PODESTA EMAIL ADDRESSES

0.1.1f.4fd.1d10aa28c5e02de.0@omp.news.united.com
001a11344fbae1f87d0513ca9ca4@google.com
007@gmail.com
00be2787-0492-411d-833f-feeed159f3b9@podesta.com
00df270fe2114d499b222c5c946150c6@namprd03.prod.outlook.com
00f2bf99d32551d0fb066ff8ea9ec6ef@mail.gmail.com
015@gmail.com
017a59bf6ebf388e35450b7fa3553d66@bounce.bluestatedigital.com
01a95b4af08da20f1322c3db67800b40@mail.gmail.com
01d4dfa3-b5f9-4f27-9a4d-83398b339224@gmail.com
02e860b1027d7c0e3dbcbe0e603a763b7cb.20150729101159@morning1.theskimm.com
02e860b1027d7c0e3dbcbe0e603a763b7cb.20150805101830@morning1.theskimm.com
02e860b1027d7c0e3dbcbe0e603a763b7cb.20150806101856@morning2.theskimm.com
02e860b1027d7c0e3dbcbe0e603a763b7cb.20150811102016@morning1.theskimm.com
032eb1b9-6339-4d28-b227-df6535895639@americanbridge.org
0361598e-932a-4941-a96c-1b9f1b36f112@mit.edu
036d6a8c8ef92d4ba4e97ed3ef60b7b1@exch031.domain.local
03e9c13f32bd7c4e8a141e6bffc0a4cb1c0c213b@phxmb3.corp.fleishman.com
03eb52e083e9f44db891deaa4e1f8226@exchange.mit.edu
0437bcce-37e6-43cc-a9af-2e985540b0a6@gmail.com
04450da8-9460-4e1e-8566-7d163424a4c1@americanprogress.org
044h7cpzjx0oquzgjg@mail.gmail.com
047d7bd9165ab3886b052b34a2f5@google.com
047e6e56d45307c01592866859814ca0@bounce.bluestatedigital.com
055ad200229ff96d21572ea71fce6ea8@mail.gmail.com
05d9343b523e1446adf2228b188e78ea23454a4545@lcvexchange.lcv.local
05d9343b523e1446adf2228b188e78ea234bb0189e@lcvexchange.lcv.local
06b481f7-106a-4443-a89e-dc92435387a0@presidentclinton.com
07+x82xjx78qcysb+a4rtgsd1vqq@mail.gmail.com
08b55b341dd45526c8b5ef3d1faef30f@mail.gmail.com
08f08d095a7f234483082e73bfac42f8@namprd03.prod.outlook.com
0902ee3f8cac70499ea14edadc7c3a93dce71c@svr-gais-dc-01.gaisberg.local
0902ee3f8cac70499ea14edadc7c3a93de8aac@svr-gais-dc-01.gaisberg.local
09107248-a6d5-4396-9878-9c7e6f35142c@mit.edu
094e38ae-0c9b-4558-8945-eabaf590f006@algpolling.com
09725f588a8ce4a6ce9ae11d33d797c559a.20150304122246@mail18.wdc01.mcdlv.net
09cd2499-9990-45c0-a10f-077b7ecf7470@progressivemediausa.org
09ce2fea-f538-4213-bf3d-1215e6baa7d8@mit.edu
0@genius-network.com
0b882647-2470-44cc-969a-53b18a2cc924@aol.com
0ba22390-f76f-41e1-a33c-c415e28037ba@gmmb.com
0ba69aecd289c94d83d76013962b17102d8a9cf5@efor-lag-11.doe.local
0c-18121-78a34e35@genius-network.com
0c02f4b1261cd944a437ed3117c864c947c2b5@nea-hq-evs2.nea.loc
0c9d0c55-031b-4164-a0a2-28937fac4910@me.com
0d114a88-3b39-4cbb-8a59-25dff18efbd0@gmail.com
0d35c3d00f794631901877a4cd3c6d46@co2pr06mb633.namprd06.prod.outlook.com
0d77a0871b6a7147bdc6b3e94c7c0941173f700878@cbivexmb05dc.cov.com
0d77a0871b6a7147bdc6b3e94c7c0941173f700881@cbivexmb05dc.cov.com
0d77dd17-31a8-40ff-a77e-d73b3aa040bf@hrcoffice.com
0d87044186622443a6ccf0eba5056b9665f89d7b@wcex1.wwics.org
0d87044186622443a6ccf0eba5056b9675cd49ff@wcm2.wwics.org
0da00bfe3116bb4db975587b3511f4e00557c908@exnjmb57.nam.nsroot.net
0da49dd27f809741aa803d1d4ba8e563a974195a@mbx031-w1-co-4.exch031.domain.local
0e0dc75f-a3b1-4434-813b-182a9fc25bb3@podesta.com
0e3a2cd9631f4c53ad36915bb3e3ebdd@johndouglassforcongress.com
0f64e6de368d4c5da8da041a99a2c5c6@scg-mbx3.scg.corp
0fa0d648-214d-4f98-ba58-7274a7e0a71e@gmail.com
0fb0284d-881f-4ac8-867f-09023f955d03@podesta.com
0fe8c6b9-d80d-4268-9edb-2e4cd27b9613@2bowles.com
0g@mail.gmail.com
0mzd00jo7grygv80@st11p01mm-asmtp003.mac.com
0mze002dilw7ww20@st11p01mm-asmtp005.mac.com
0mze004hdngioe10@st11p01mm-asmtp003.mac.com
0mze0056z8wkzk30@st11p01mm-asmtp001.mac.com
0mze00l4ceury430@st11p01mm-asmtp002.mac.com
0mzi00c8mcdqy980@st11p01mm-asmtp001.mac.com
0n9z00cy9nbl5650@st11p02mm-asmtp001.mac.com
0ngo001qeqxqh120@st11p02mm-asmtp002.mac.com
0ni400b008s9kh00@a-mtaout20.012.net.il
0ni400blc8u57na0@a-mtaout20.012.net.il
0nqn00hqu5ivdm20@phonehome.asia.apple.com
0o1u006bmrcvx660@jimbu.apple.com
0q@mail.gmail.com
10044938-4f5a-4332-8586-576b63d14f00@gmail.com
1040093531.13117484.1441814896541.javamail.root@sjmas01.marketo.org
1048986734-1224976267-cardhu_decombobulator_blackberry.rim.net-1132011788-@bxe245.bisx.prod.on
110120080238.14662.490bc1260008730a00003946221652585697019d02010c04040e990a9c@comcast.net
110120080300.12008.490bc631000756e200002ee8221652585697019d02010c04040e990a9c@comcast.net
110120081152.28161.490c430a0004b58600006e01221202078497019d02010c04040e990a9c@comcast.net
110350587.1006411.1455314606300.javamail.root@townhallmail.com
1114813973856.1101360615949.43405.3.30112049@scheduler.constantcontact.com
1115452317206.1101360615949.43405.3.13094517@scheduler.constantcontact.com
1117194852797.1101987856365.1054729873.0.1111752jl.1002@scheduler.constantcontact.com
1117326822096.1101987856365.1054729873.0.1151832jl.1002@scheduler.constantcontact.com
1117510065298.1101987856365.1054729873.0.1121753jl.1002@scheduler.constantcontact.com
1117838709694.1101987856365.1054729873.0.1291828jl.1002@scheduler.constantcontact.com
1117909649039.1101987856365.1054729873.0.1241854jl.1002@scheduler.constantcontact.com
1117972564457.1101987856365.1054729873.0.1031748jl.1002@scheduler.constantcontact.com
1118035152580.1101987856365.1054729873.0.861845jl.1002@scheduler.constantcontact.com
1118098626236.1101987856365.1054729873.0.1021743jl.1002@scheduler.constantcontact.com
1118204576895.1115496907910.2024446626.0.400704jl.1002@scheduler.constantcontact.com
1118227729501.1101987856365.1054729873.0.1151825jl.1002@scheduler.constantcontact.com
1118392824518.1011284163030.1239.0.201441jl.1002@scheduler.constantcontact.com
1119206109108.1115496907910.2024446626.0.411203jl.1002@scheduler.constantcontact.com
1120630492171.1101987856365.1054729873.0.1001826jl.1002@scheduler.constantcontact.com
1120918077998.1108033526683.5529.0.161554jl.1002@scheduler.constantcontact.com
1121427746263.1101987856365.1054729873.0.1111955jl.1002@scheduler.constantcontact.com
1121689985206.1101987856365.1054729873.0.1121850jl.1002@scheduler.constantcontact.com
1121778796766.1101665244433.89092.0.71351jl.1002@scheduler.constantcontact.com
1122013985317.1101987856365.1054729873.0.1561745jl.1002@scheduler.constantcontact.com
1122219506142.1102433536755.3497.0.341512jl.1002@scheduler.constantcontact.com
1122222163589.1101987856365.1054729873.0.1251859jl.1002@scheduler.constantcontact.com
1122294487325.1101987856365.1054729873.0.1491844jl.1002@scheduler.constantcontact.com
1122335585980.1108033526683.5529.0.121111jl.1002@scheduler.constantcontact.com
1122662792852.1101987856365.1054729873.0.1141847jl.1002@scheduler.constantcontact.com
1123167496257.1101987856365.1054729873.0.871728jl.1002@scheduler.constantcontact.com
1123715622339.1101987856365.1054729873.0.611801jl.1002@scheduler.constantcontact.com
1123788838226.1101987856365.1054729873.0.631752jl.1002@scheduler.constantcontact.com
1123857852329.1101987856365.1054729873.0.721805jl.1002@scheduler.constantcontact.com
11574cec883b522e112bacac4f8a9962@mail.gmail.com
1159c66a-000e-4184-a64f-0904b9639e3a@ploughshares.org
116aa2.b96d78f.42ed1c06@aol.com
11981e.5a4a77a0.3ec80c77@aol.com
11997ee22fc0cc31ffcd642d71e4ef00@mail.gmail.com
11f4941c2987d147be2d5d17882d1e2f@namprd03.prod.outlook.com
1205688482-1228749150-cardhu_decombobulator_blackberry.rim.net-1907948411-@bxe270.bisx.prod.on
1228230512.18951.johnson_lo@mail2000.com.tw
1229098902.79611.johnson_lo@mail2000.com.tw
123456xyz@gmail.com
126c9c51-fc8e-4441-b6f2-0aaa490fb55d@gmail.com
1299350637.810640787.1449237868723.javamail.root@sjmas03.marketo.org
12c2479ccf0735771face2d95f88621e@mail.gmail.com
12c7cd9f433f9a73481efaa09d31b5459a5.20160229164005@mail210.atl21.rsgsv.net
1327270e-a5dc-44c4-b31b-f39b385fd6a5@gmail.com
133d6dcd35674b29b2898a3557fb7251@co1pr07mb313.namprd07.prod.outlook.com
1342544286.1623690864.1454693521240.javamail.root@sjmas02.marketo.org
1361941632.7892573.1457471366129.javamail.root@townhallmail.com
13651f746f48084d8ba52cf09604b8ee@namprd07.prod.outlook.com
1374121488-1232413-org2-org2db@bounces.salsalabs.net
1374121488.-1811020613@org2.org2db.mail.democracyinaction.org
137dc8f95edcceb1265f7c5a3ea07bdc@mail.gmail.com
1393211177.-1643775883@org.orgdb.mail.democracyinaction.org
13d0c4ee04919a2127f6c596030c8959f18.20151227224439@mail143.atl101.mcdlv.net
1406765852.23970886.1443022824982.javamail.root@sjmas01.marketo.org
1414583252-1179993-org-orgdb@bounces.salsalabs.net
1414583252.-1183301698@org.orgdb.mail.democracyinaction.org
1415812847.28260.yahoomailneo@web181305.mail.ne1.yahoo.com
1422357987404.6740@albrightstonebridge.com
1423937785201.41253@hrcoffice.com
1425218346287.60413@americanprogress.org
1427731368337.7173@americanprogress.org
1430503814648.23251@hrcoffice.com
1432214938.32400@paypal.com
1437338700-1182202-org-orgdb@bounces.salsalabs.net
1437338700.1113370964@org.orgdb.mail.democracyinaction.org
1456905082-1183288-org-orgdb@bounces.salsalabs.net
1456905082.328220127@org.orgdb.mail.democracyinaction.org
14816d31-e6b6-4527-af24-10e78eee9d81@gmail.com
1499481109.715617324.1407427312335.javamail.root@sjmas01.marketo.org
14b4abd0bb0-1062-55e0@webprd-m34.mail.aol.com
14c248e9be3-18c5-3904@webprd-a23.mail.aol.com
14cecc559b6-4fdd-14add@webprd-m58.mail.aol.com
14d10aef3a2-4e9b-80d3@webprd-a75.mail.aol.com
14d10ba7436-4e9b-81fd@webprd-a75.mail.aol.com
14d1c0a482a-48a5-16158@webprd-m104.mail.aol.com
14d1f722ae1-48a5-1a362@webprd-m104.mail.aol.com
14e8d444ca8-1174-d3ba@webprd-a03.mail.aol.com
14f36ddfc94-95e-85bd@webprd-a39.mail.aol.com
1500552026.8311300.1457556655488.javamail.root@townhallmail.com
1503454f762-6f1c-216e2@webprd-m74.mail.aol.com
1509a57c3a5-3706-462d@webprd-a101.mail.aol.com
1509b15894c-3706-4bef@webprd-a101.mail.aol.com
15270e9b358-5ed4-4130@webprd-m100.mail.aol.com
1529169880.4888233.1456953683541.javamail.root@townhallmail.com
152c2853f8f-d65-546a@webprd-a51.mail.aol.com
152c28b8fef-bf0-551a@webprd-a94.mail.aol.com
1530581cd8d-612d-3b9c@webstg-a03.mail.aol.com
1549105534.441800896.1441034107459.javamail.root@sjmas02.marketo.org
1551090517.5329364.1457042083880.javamail.root@townhallmail.com
1559643107.5120361.1458471946237.javamail.root@townhallmail.com
15@gmail.com
15f16c2a-bd66-458d-93f3-fb8ce1f14972@xtgap4s7mta1379.xt.local
161022330.429006384.1447424295228.javamail.root@sjmas01.marketo.org
1614235294.1248146422.1451521360867.javamail.root@sjmas03.marketo.org
1657587471-1201721-org-orgdb@bounces.salsalabs.net
1657587471.-886395918@org.orgdb.mail.democracyinaction.org
1663603638.600851739.1448914457017.javamail.root@sjmas02.marketo.org
17255319-bf49-467b-9e22-d4eaac7b9efb@xtgap4s7mta1377.xt.local
1775713970.596933144.1441630893070.javamail.root@sjmas02.marketo.org
17@clintonemail.com
17a089db0804220913j3e54df3bk8dbd6246147844c9@mail.gmail.com
17a089db0804290510v42608a48xfa5262aabe276127@mail.gmail.com
17a089db0804291309j77f66576ledd71155f82fe6c1@mail.gmail.com
17a089db0804300539ob890ff6h175763ac3d25841c@mail.gmail.com
17a089db0805140510k2854e0f1g1bd44842d80134d1@mail.gmail.com
17a089db0805210515r282d0a3ey7279d04be4198f2d@mail.gmail.com
17a089db0805230540y585e0598oca037ab3edc945e5@mail.gmail.com
17a089db0805270512h7c5013a1p57132720ef7594f0@mail.gmail.com
17a089db0806030528q73c09cb1m1e47c35552eabd01@mail.gmail.com
17a089db0806040526o2cd6ec65pea56f7f3df218191@mail.gmail.com
17a089db0806041142m3654688bu1fbab8c813cb37e2@mail.gmail.com
17a089db0806050532x42f00b34o5979aa1f477fa2d8@mail.gmail.com
17a089db0806051259q6f64b021te50876d205509d02@mail.gmail.com
17a089db0806060524s3c583ad0v6536900f3324f64b@mail.gmail.com
17a089db0806090509y610a4772m7a63530b6a65fe04@mail.gmail.com
17a089db0806110515l32a5cb18g75949e332e9d2f5c@mail.gmail.com
17a089db0806111027u64302ea3idba4b64be3326e01@mail.gmail.com
17a089db0806121301l2c2196evd55bb21e65ed9d4c@mail.gmail.com
17a089db0806122138ke5c5480vd695776bd6bf0bd7@mail.gmail.com
17a089db0806131010r10e2a6b6qc4ac5f201e26c6f0@mail.gmail.com
17a089db0806160523o69256489jc0fc501cf7194839@mail.gmail.com
17a089db0806170534g20ba0f42h4cb5538e02ab4c22@mail.gmail.com
17a089db0806180541j29e65667pd4a8fe34947c7d85@mail.gmail.com
17a089db0806181457l470ab249md94d102beb56a31b@mail.gmail.com
17a089db0806200535t2ea3a881md8b300ce5a72d7b5@mail.gmail.com
17a089db0806260543n6183c31o215578ae024be13b@mail.gmail.com
17a089db0806270519u23e5218p3cd5e568bee2c6f0@mail.gmail.com
17a089db0806300543q2418be68nc87649469ef19058@mail.gmail.com
17b2728656e75449b3142fcf309604b7@exchange.mit.edu
17eefc589c8db54f4d9afa7f8d1c4d0d@mail.gmail.com
1829435706.521035.1455228268901.javamail.root@townhallmail.com
1860288242.4222309.1458159239233.javamail.root@townhallmail.com
189601-7204487-50@mail.nbcnews.com
18d76772bf7626dc57958d46f5aec7bd@mail.gmail.com
1933489518.11839401376924541955.javamail.root@hyram.iad01.hubspot-networks.net
19498ec7-46cb-4fb6-9d82-baf017725153@gmail.com
1957921513.731729735.1407769404227.javamail.root@sjmas02.marketo.org
1978132d4065a410f14db55a604f2ccd@mail.gmail.com
1995180436-169121-wfc-wfcdb@bounces.salsalabs.net
1995180436.409771345@wfc.wfcdb.reply.salsalabs.com
19fa8fa97e14c0409bea44db84794218@namprd03.prod.outlook.com
1a26aad2c3e3c90b3a185aac977cab36@bounce.bluestatedigital.com
1a484c9c32b526468802b7c2e6fd1bceb32f9d91@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb32fa42b@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb32faaf5@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb32fade0@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb3328a9e@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb349d664@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb349e723@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb34c7c5e@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb34e9cdc@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb34eabf3@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb35b4c5d@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb368824f@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb3688257@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb368f135@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb368fc0f@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb36f6086@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb36f61de@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb36f6867@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb37066c1@mbx031-w1-co-6.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb4958cec@mbx031-w2-co-2.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb4959108@mbx031-w2-co-2.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb4959448@mbx031-w2-co-2.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb49595dc@mbx031-w2-co-2.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb4959b8e@mbx031-w2-co-2.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb495ba75@mbx031-w2-co-2.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb56af8da@mbx031-w1-co-2.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb589e4d2@mbx031-w1-co-2.exch031.domain.local
1a484c9c32b526468802b7c2e6fd1bceb58b3249@mbx031-w1-co-2.exch031.domain.local
1a5f6ce2-bf62-42e3-a41e-f9db2dda96c3@gmail.com
1aaafc24-b9b8-47b4-8822-a04cf4c623b9@xtgap4s7mta4182.xt.local
1ac76bcb-d718-4443-a585-34246f96a2fc@gmail.com
1acc608f0809121411i28d45ae7uba64ef10af955993@mail.gmail.com
1af53258-a1d3-4888-8642-7f4fec642b7c@americanbridge.org
1b00035490093d4a9609987376e3b8331ca45f8f@manny.obama.local
1b00035490093d4a9609987376e3b8332b9bae1c@manny.obama.local
1b00035490093d4a9609987376e3b8332c1aec9f@manny.obama.local
1b00035490093d4a9609987376e3b8332c2e3792@manny.obama.local
1b60e6f7943d1140b20ebfa1463a7be5@fleishman.com
1beda66e-7033-4e3d-b8d3-6e64d1e153ad@nsnetwork.org
1c167da5-eb51-4401-be83-edd51bba8de6@gmail.com
1cbed6247ac65445bf49bfdd3cc5dbc601fd2999@osinyexch.soros.org
1df40c331a077467be89b14ee201f12b@mail.gmail.com
1e29fa45-b56c-4bd2-b0ef-1026c60031f5@progressivemediausa.org
1e3a32c2-cd24-42da-a86d-820af193f17a@gmail.com
1ea62b86-8be1-4de8-b8da-661463aa735e@bsgco.com
1eb2be430711282010s266b8b14je63dbf38a8687d70@mail.gmail.com
1eb2be430712041614y30cf8b45x30bf208f992f77ba@mail.gmail.com
1f7d93024b81bd498c946b4b358ea7f7@fleishman.com
1f8677642cd0f44d8caae0c0ced69539c64736@dc12.podesta.com
1fef5.1f95fd33.3e88b19c@aol.com
20090729174632.3748.10042.qmail@omail6.sac.getactive.com
20100408134528.29455.9110.qmail@omail6.sac.getactive.com
20150417-14531133-397f8a4c-0@v84.vx-email.com
20150520-11575559-e297352a-0@v84.vx-email.com
20150623-17560454-93e1bac0-0@v84.vx-email.com
20150624071716.4624471.430657@sailthru.com
20150625072946.4631940.426721@sailthru.com
20150626072444.4639182.424033@sailthru.com
20150707-14520356-20f50a87-0@v84.vx-email.com
20150708-15383924-55c59d26-0@v84.vx-email.com
20150709071246.4718719.386849@sailthru.com
20150715-14292453-40a619c0-0@v84.vx-email.com
20150720071138.4784549.332257@sailthru.com
20150721072059.4791911.330657@sailthru.com
20150729071648.4842561.307233@sailthru.com
20150731-08411774-48271998-0@v84.vx-email.com
20150805072001.4886738.299137@sailthru.com
20150806075420.4894602.298369@sailthru.com
20150811072955.4924029.294145@sailthru.com
20150812072600.4931428.291873@sailthru.com
20150814073514.4946064.284993@sailthru.com
20150817071001.4961437.282849@sailthru.com
20150918-15264023-154ddd53-0@v84.vx-email.com
20150922-18000050-1113df44-0@v84.vx-email.com
20150924-13355490-6db59be0-0@v84.vx-email.com
20150929-13514651-d60e1b1d-0@v84.vx-email.com
20151001-12385361-4682a44e-0@v84.vx-email.com
20151002-13140759-ab55fd43-0@v84.vx-email.com
20151013-18460807-a0d75584-0@v84.vx-email.com
20151021-13242239-c6a32328-0@v84.vx-email.com
20151027152840.4cf7429002@medusa.knowall.net
20151028161139.3a49728ed5@medusa.knowall.net
20151103-17495097-51b44eaf-0@v84.vx-email.com
20151103081752.5462024.164417@sailthru.com
20151105082501.5477074.155265@sailthru.com
20151106080858.5484308.154529@sailthru.com
20151110081249.5506351.152545@sailthru.com
20151112080446.5520593.148257@sailthru.com
20151115095332.5540341.127489@sailthru.com
20151120-17033055-ec559f99-0@v84.vx-email.com
20151124080743.5597577.123073@sailthru.com
20151125074529.5605712.122497@sailthru.com
20151201-17254607-d53221fa-0@v84.vx-email.com
20151204081337.5661224.119809@sailthru.com
20151208-18115109-09542ef0-0@v84.vx-email.com
20151209081020.5691551.484429@sailthru.com
20151210-13050643-dbad6777-0@v84.vx-email.com
20151215-22111058-6a4cce6b-0@v84.vx-email.com
20151215174835.5734855.481902@sailthru.com
20151216-14532185-d06ad555-0@v84.vx-email.com
20151221080922.5768622.478042@sailthru.com
20151222-16502594-f7e31be5-0@v84.vx-email.com
20151223084132.5784671.475097@sailthru.com
20151224071711.5791415.471385@sailthru.com
20151228074826.5808849.467306@sailthru.com
20151230084640.5822715.463126@sailthru.com
20151230130731.5824278.116858@sailthru.com
2015@gmail.com
20160104-11025761-696750d6-0@v84.vx-email.com
20160105-18212184-1b790169-0@v84.vx-email.com
20160107083246.5867926.459617@sailthru.com
20160111-11304929-f74f7a6f-0@v84.vx-email.com
20160122-12375592-23c18c3f-0@v84.vx-email.com
20160125-14032803-d4289272-0@v84.vx-email.com
20160126-16542088-d71ccfc0-0@v84.vx-email.com
20160126085731.5983511.427393@sailthru.com
20160202-12490597-1a814e5e-0@v84.vx-email.com
20160202-17254987-dae724bf-0@v84.vx-email.com
20160205-11153876-7ff38b11-0@v84.vx-email.com
20160214093804.6105674.402177@sailthru.com
20160217-13043428-59318196-0@v84.vx-email.com
20160218-10340747-edd40614-0@v84.vx-email.com
20160221025103.aok18423.viepfeppe48-int.chello.at@edge03.upcmail.net
20160221025114.opgx22449.viepfeppe41-int.chello.at@edge03.upcmail.net
20160221102113.6148827.390785@sailthru.com
20160221201014.zqzs3539.viepfeppe49-int.chello.at@edge03.upcmail.net
20160223-13342568-cc881834-0@v84.vx-email.com
20160223-14024709-655dfde7-0@v84.vx-email.com
20160229083256.6197556.381537@sailthru.com
20160301-13003579-cd136efb-0@v84.vx-email.com
20160301-14564717-f712f365-0@v116.vx-email.com
20160301-18304927-9fde3375-0@v84.vx-email.com
20160308-19014348-585ae919-0@v84.vx-email.com
2016235093-1233068-org-orgdb@bounces.salsalabs.net
2016235093.610151567@org.orgdb.mail.democracyinaction.org
2024b1fcfd37fc478bcd92ec0508319f06b0f7785b@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77c23@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77c2d@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77e92@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77e99@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77ebc@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77ec4@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77ec9@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77ed0@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77ed2@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77edc@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77ee9@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77eee@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77eef@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77ef0@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77ef3@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77ef4@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77f2f@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f77f44@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f78008@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f78021@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f78026@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f78028@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f78030@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f78038@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f78047@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f78056@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f78106@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b0f78109@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b4bd76f0@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b4bd7732@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b53d5e31@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b54fa7fa@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b62cbe1f@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06b66fa4c9@cbivexmb05dc.cov.com
2024b1fcfd37fc478bcd92ec0508319f06c115627a@cbivexmb05dc.cov.com
20351433-4fe2-4a69-a5ae-8b3c4fb8e2b2@xtgap4s7mta1357.xt.local
2078142551.488396094.1447790449656.javamail.root@sjmas01.marketo.org
2088457046-1225536042-cardhu_decombobulator_blackberry.rim.net-295377561-@bxe245.bisx.prod.on
20b1ce4d-5ee6-43b1-bff9-867c69baad86@saban.com
21141408e32dd20d2cbd983a8dce736a@mail.gmail.com
2136029550-174512-wfc-wfcdb@bounces.salsalabs.net
2136029550.2078526963@wfc.wfcdb.reply.salsalabs.com
214142600811052007g65d6c52aydf62a894beaa5c4f@mail.gmail.com
215ff49f-af84-417a-9511-44c53b708cd1@aol.com
216ebcf4-2d0b-4afe-a815-fd97f78728f2@gmail.com
219-mvu-643.0.13720.0.0.16156.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.13749.0.0.16189.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.14630.0.0.16745.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.14630.0.0.16746.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.14901.0.0.16950.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.15022.0.0.17169.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.15022.0.0.17170.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.15484.0.0.17726.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.15899.0.0.18035.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.16065.0.0.18178.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.16065.0.0.18179.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.16157.0.0.18237.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.16759.0.0.18717.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.17268.0.0.19211.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.7619.0.0.9946.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.7619.0.0.9947.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.7874.0.0.10250.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.7874.0.0.10251.7.44418@em-sj-77.mktomail.com
219-mvu-643.0.9161.0.0.12066.7.44418@em-sj-77.mktomail.com
2204831040-1301660-org2-org2db@bounces.salsalabs.net
2204831040.-788480341@org2.org2db.reply.salsalabs.com
2206007838-1301727-org2-org2db@bounces.salsalabs.net
2206007838.322157297@org2.org2db.reply.salsalabs.com
2206716331-1301792-org2-org2db@bounces.salsalabs.net
2206716331.-1582123215@org2.org2db.reply.salsalabs.com
2207785010-1301960-org2-org2db@bounces.salsalabs.net
2207785010.1417971274@org2.org2db.reply.salsalabs.com
2210073121-1302195-org2-org2db@bounces.salsalabs.net
2210073121.-1496957204@org2.org2db.reply.salsalabs.com
2212125260-1302363-org2-org2db@bounces.salsalabs.net
2212125260.-679841318@org2.org2db.reply.salsalabs.com
2213082651-1302448-org2-org2db@bounces.salsalabs.net
2213082651.1255184716@org2.org2db.reply.salsalabs.com
2214444433-1302569-org2-org2db@bounces.salsalabs.net
2214444433.1173054242@org2.org2db.reply.salsalabs.com
2216701711-1302784-org2-org2db@bounces.salsalabs.net
2216701711.598539982@org2.org2db.reply.salsalabs.com
2217419950-1302895-org2-org2db@bounces.salsalabs.net
2217419950.-908591144@org2.org2db.reply.salsalabs.com
2223150456-1303469-org2-org2db@bounces.salsalabs.net
2223150456.-280879245@org2.org2db.reply.salsalabs.com
2226754478-1303724-org2-org2db@bounces.salsalabs.net
2226754478.-908161164@org2.org2db.reply.salsalabs.com
2228363903-1303833-org2-org2db@bounces.salsalabs.net
2228363903.-784688725@org2.org2db.reply.salsalabs.com
222e1ce112c1e6d2f32cbca1cb77a355@mail.gmail.com
2231006354-1304122-org2-org2db@bounces.salsalabs.net
2231006354.850319148@org2.org2db.reply.salsalabs.com
2232034514-1304201-org2-org2db@bounces.salsalabs.net
2232034514.-534850824@org2.org2db.reply.salsalabs.com
2233225474-1304274-org2-org2db@bounces.salsalabs.net
2233225474.-87447878@org2.org2db.reply.salsalabs.com
2233885911-1304302-org2-org2db@bounces.salsalabs.net
2233885911.-587181504@org2.org2db.reply.salsalabs.com
2237028389-1304698-org2-org2db@bounces.salsalabs.net
2237028389.1558275170@org2.org2db.reply.salsalabs.com
2238773748-1304905-org2-org2db@bounces.salsalabs.net
2238773748.1066071390@org2.org2db.reply.salsalabs.com
2239123165-1304915-org2-org2db@bounces.salsalabs.net
2239123165.1091756180@org2.org2db.reply.salsalabs.com
2243329510-1305505-org2-org2db@bounces.salsalabs.net
2243329510.-990727715@org2.org2db.reply.salsalabs.com
2245185180-1305683-org2-org2db@bounces.salsalabs.net
2245185180.-1042073136@org2.org2db.reply.salsalabs.com
2252482298-1306483-org2-org2db@bounces.salsalabs.net
2252482298.1103118464@org2.org2db.reply.salsalabs.com
2253512095-1306627-org2-org2db@bounces.salsalabs.net
2253512095.-99917152@org2.org2db.reply.salsalabs.com
2260653712.4@informz.net
2269062539-1308011-org2-org2db@bounces.salsalabs.net
2269062539.-133464141@org2.org2db.reply.salsalabs.com
2270311696-1308120-org2-org2db@bounces.salsalabs.net
2270311696.-1450831685@org2.org2db.reply.salsalabs.com
2276248509-1308809-org2-org2db@bounces.salsalabs.net
2276248509.1239089848@org2.org2db.reply.salsalabs.com
2277901742-1309043-org2-org2db@bounces.salsalabs.net
2277901742.-1510885130@org2.org2db.reply.salsalabs.com
2280e9-215-561bf6e3@list.prochoiceamerica.org
2280e9-2a4-56632699@list.prochoiceamerica.org
2285487916-1309882-org2-org2db@bounces.salsalabs.net
2285487916.-1412168196@org2.org2db.reply.salsalabs.com
2286596467-1310020-org2-org2db@bounces.salsalabs.net
2286596467.-1960148063@org2.org2db.reply.salsalabs.com
2298022412.4@informz.net
2298041238-1310854-org2-org2db@bounces.salsalabs.net
2298041238.-274050794@org2.org2db.reply.salsalabs.com
22dcddc580fa32408250778495277bb2ac85fbe7@law-mbx01.law.georgetown.edu
2300445315-1311035-org2-org2db@bounces.salsalabs.net
2300445315.-1925516295@org2.org2db.reply.salsalabs.com
230c64c3dbe3f04f9e3d58934e6dbe23@cdsmail.pvt
2312471914-1312402-org2-org2db@bounces.salsalabs.net
2312471914.1203544692@org2.org2db.reply.salsalabs.com
2313107769-1312502-org2-org2db@bounces.salsalabs.net
2313107769.230855553@org2.org2db.reply.salsalabs.com
2329405031-1313899-org2-org2db@bounces.salsalabs.net
2329405031.-1335857761@org2.org2db.reply.salsalabs.com
232a4a45176fccacab865e520a7f9100a75.20140729150129@mail175.atl81.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20140801140256@mail66.atl31.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20140805131410@mail188.atl21.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20140807135331@mail191.atl121.mcsv.net
232a4a45176fccacab865e520a7f9100a75.20140811124624@mail172.wdc02.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20140813140318@mail53.atl31.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20150126143148@mail13.atl161.mcsv.net
232a4a45176fccacab865e520a7f9100a75.20150305155115@mail93.atl71.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20150429151342@mail192.wdc02.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20150508073944@mail98.atl71.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20150520082110@mail128.wdc02.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20150624070212@mail190.atl171.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20150625070139@mail191.wdc02.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20150626073134@mail169.atl171.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20150707063136@mail99.atl51.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20150708104625@mail208.atl171.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20150709074945@mail71.atl111.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20150715062747@mail222.atl21.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20150720095259@mail3.wdc03.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20150721075947@mail3.wdc03.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20150723064928@mail96.atl161.mcsv.net
232a4a45176fccacab865e520a7f9100a75.20150727032917@mail128.wdc02.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20150729120511@mail99.atl11.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20150803044555@mail69.suw11.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20150805090129@mail82.suw11.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20150819111410@mail147.atl61.mcsv.net
232a4a45176fccacab865e520a7f9100a75.20150820094940@mail147.atl61.mcsv.net
232a4a45176fccacab865e520a7f9100a75.20150821084815@mail147.atl61.mcsv.net
232a4a45176fccacab865e520a7f9100a75.20150825083350@mail164.atl61.mcsv.net
232a4a45176fccacab865e520a7f9100a75.20150828072239@mail146.atl21.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20150903072900@mail183.atl81.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20150904072303@mail38.atl11.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20150907064744@mail9.atl71.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20150917160809@mail36.wdc03.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20150918143918@mail130.wdc02.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20151002152609@mail217.atl21.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20151012135541@mail20.us4.mcsv.net
232a4a45176fccacab865e520a7f9100a75.20151026135746@mail77.atl11.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20151027141759@mail90.atl161.mcsv.net
232a4a45176fccacab865e520a7f9100a75.20151102155207@mail48.suw11.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20151103152022@mail82.suw15.mcsv.net
232a4a45176fccacab865e520a7f9100a75.20151105152616@mail65.suw15.mcsv.net
232a4a45176fccacab865e520a7f9100a75.20151110122033@mail54.atl51.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20151112075917@mail215.suw16.rsgsv.net
232a4a45176fccacab865e520a7f9100a75.20151113144146@mail90.suw11.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20151116152329@mail7.atl161.mcsv.net
232a4a45176fccacab865e520a7f9100a75.20151127155322@mail75.suw11.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20151202154135@mail69.atl31.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20151203155022@mail68.suw11.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20151221145652@mail46.atl71.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20151223155518@mail34.suw17.mcsv.net
232a4a45176fccacab865e520a7f9100a75.20151224155754@mail200.suw14.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20151230155012@mail42.suw15.mcsv.net
232a4a45176fccacab865e520a7f9100a75.20160107152750@mail34.atl71.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20160121153310@mail155.atl171.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20160122153940@mail164.atl171.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20160215152206@mail186.suw14.mcdlv.net
232a4a45176fccacab865e520a7f9100a75.20160318135545@mail44.suw15.mcsv.net
2332249106-1314077-org2-org2db@bounces.salsalabs.net
2332249106.1964623899@org2.org2db.reply.salsalabs.com
2339295580-1314717-org2-org2db@bounces.salsalabs.net
2339295580.1297745307@org2.org2db.reply.salsalabs.com
2346084223-1315402-org2-org2db@bounces.salsalabs.net
2346084223.-1453196902@org2.org2db.reply.salsalabs.com
2346963401-1315471-org2-org2db@bounces.salsalabs.net
2346963401.-682547149@org2.org2db.reply.salsalabs.com
2348204402-1315565-org2-org2db@bounces.salsalabs.net
2348204402.36695336@org2.org2db.reply.salsalabs.com
2349447125-1315680-org2-org2db@bounces.salsalabs.net
2349447125.-880595744@org2.org2db.reply.salsalabs.com
2357482852-1316384-org2-org2db@bounces.salsalabs.net
2357482852.-224038787@org2.org2db.reply.salsalabs.com
2363614894-1316756-org2-org2db@bounces.salsalabs.net
2363614894.-2121769247@org2.org2db.reply.salsalabs.com
2365182943-1316820-org2-org2db@bounces.salsalabs.net
2365182943.-1507695183@org2.org2db.reply.salsalabs.com
2365675199-1316836-org2-org2db@bounces.salsalabs.net
2365675199.1732799402@org2.org2db.reply.salsalabs.com
2373736912-1317239-org2-org2db@bounces.salsalabs.net
2373736912.-1794052018@org2.org2db.reply.salsalabs.com
2374881444-1317289-org2-org2db@bounces.salsalabs.net
2374881444.1386906957@org2.org2db.reply.salsalabs.com
2375649355-1317361-org2-org2db@bounces.salsalabs.net
2375649355.-190976202@org2.org2db.reply.salsalabs.com
2376093146-1317457-org2-org2db@bounces.salsalabs.net
2376093146.1382182805@org2.org2db.reply.salsalabs.com
2377034978-1317561-org2-org2db@bounces.salsalabs.net
2377034978.1819874453@org2.org2db.reply.salsalabs.com
2377896625-1317655-org2-org2db@bounces.salsalabs.net
2377896625.1554916914@org2.org2db.reply.salsalabs.com
2379881830-1317807-org2-org2db@bounces.salsalabs.net
2379881830.-820110122@org2.org2db.reply.salsalabs.com
2381343509-1317979-org2-org2db@bounces.salsalabs.net
2381343509.57319786@org2.org2db.reply.salsalabs.com
2382618096-1318141-org2-org2db@bounces.salsalabs.net
2382618096.1463649293@org2.org2db.reply.salsalabs.com
2385283394-1318433-org2-org2db@bounces.salsalabs.net
2385283394.1261905658@org2.org2db.reply.salsalabs.com
2385664776-1318438-org2-org2db@bounces.salsalabs.net
2385664776.-229707081@org2.org2db.reply.salsalabs.com
2391366222-1319011-org2-org2db@bounces.salsalabs.net
2391366222.-826598675@org2.org2db.reply.salsalabs.com
2392826435-1319090-org2-org2db@bounces.salsalabs.net
2392826435.-1333406299@org2.org2db.reply.salsalabs.com
2397281293-1319496-org2-org2db@bounces.salsalabs.net
2397281293.826125112@org2.org2db.reply.salsalabs.com
2401053294-1319753-org2-org2db@bounces.salsalabs.net
2401053294.1863774312@org2.org2db.reply.salsalabs.com
2407257831-1320413-org2-org2db@bounces.salsalabs.net
2407257831.165188244@org2.org2db.reply.salsalabs.com
2408216256-1320502-org2-org2db@bounces.salsalabs.net
2408216256.-15201542@org2.org2db.reply.salsalabs.com
2414163474-1321119-org2-org2db@bounces.salsalabs.net
2414163474.-84155167@org2.org2db.reply.salsalabs.com
2414576370-1321126-org2-org2db@bounces.salsalabs.net
2414576370.-1090981143@org2.org2db.reply.salsalabs.com
2418624c3dae60ead88e3f2a746357bc@mail.gmail.com
2419071621-1264260-org-orgdb@bounces.salsalabs.net
2419071621.1858121885@org.orgdb.mail.democracyinaction.org
2430036436-1264565-org-orgdb@bounces.salsalabs.net
2430036436.-470092708@org.orgdb.mail.democracyinaction.org
24635e9a-03e2-458c-b551-70da3f2e2755@americanbridge.org
24656fd7-4de0-4e93-9a22-083b1cb9602e@gmail.com
248d82cd3782c84d953aa03e46ace2fe@bounce.bluestatedigital.com
2495499754-1270287-org-orgdb@bounces.salsalabs.net
2495499754.-1198865630@org.orgdb.mail.democracyinaction.org
24be1118e6623a44970c232d0b0c26b502f8ab28@sessml35u.ses.state.sbu
24d3105f-5d3d-4866-86d6-7724ddc42611@americanbridge.org
2508636256-1271201-org-orgdb@bounces.salsalabs.net
2508636256.1042416710@org.orgdb.mail.democracyinaction.org
251d47fd-f89a-4c73-9064-d2c05acf461e@xtnvmta4102.xt.local
25229802.1764842.1605778922@e2ma.net
2571ba9e-9a04-41df-8455-b44f6f0848db@presidentclinton.com
2642911e-baf6-4e49-b05c-ce960a422b06@progressivemediausa.org
264993204-1218045614-cardhu_decombobulator_blackberry.rim.net-1329038853-@bxe029.bisx.prod.on
26529b935ba4ab271796cadd8cd6420d@mail.gmail.com
2698216539.4@informz.net
2715703239.4@informz.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20150731150256@mail183.atl81.rsgsv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20151008170140@mail176.atl121.mcsv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20151015185042@mail138.atl171.mcdlv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20151015190155@mail143.atl171.mcdlv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20151105152512@mail44.wdc01.mcdlv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20151112141622@mail52.atl161.mcsv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20151112205905@mail21.suw11.mcdlv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20151119140126@mail178.atl171.mcdlv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20151124140146@mail69.atl161.mcsv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20151202172944@mail38.suw17.mcsv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20151202173416@mail165.atl61.mcsv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20151209142959@mail30.atl51.rsgsv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20151211150346@mail31.wdc01.mcdlv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20160114190213@mail177.suw14.mcdlv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20160121195954@mail9.atl161.mcsv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20160128214453@mail155.atl101.mcdlv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20160211210102@mail24.suw11.mcdlv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20160225210000@mail36.atl31.mcdlv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20160302193009@mail88.atl31.mcdlv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20160308190104@mail73.atl111.rsgsv.net
2768ea8e53da1b3ff17fb6a6f477e2b071c.20160310205948@mail48.suw13.rsgsv.net
2774942008.4@informz.net
2816c364-0d4a-41a2-a524-d8d8f5c02bbb@me.com
2841e861dbe6ef8f66bed9cade4e854c@mail.gmail.com
2873f8e9d28b6b97174889320dae58fd@bounce.bluestatedigital.com
289876c0-ab95-42e6-afe4-bcae14fff9d4@dixondavismedia.com
28blackwoodward@gmail.com
28don.gips@gmail.com
28e2a7a6cfc3448f91e3e1b6bfa92320@stabenowforsenate.com
28hboushey@equitablegrowth.org
28huma@clintonemail.com
28huma@clintonfoundation.org
28huma@hrcoffice.com
28info@forwardengagement.org
28jake.sullivan@gmail.com
28james.n.miller.jr@gmail.com
28john.podesta@gmail.com
28kristinakschake@gmail.com
28mariah6@gmail.com
28michaelbuckeye24@gmail.com
28mike08082013@gmail.com
28mmccloud@dmggroup.com
28mmorell@beaconglobalstrategies.com
28philip.gordon@verizon.net
28tom.nides@morganstanley.com
28twittes@brookings.edu
2932f47f-8a16-48b3-87da-1daa2fb3765e@gmail.com
296020129.25341914.1409666507209.javamail.root@sjmas01.marketo.org
296bbe050712041350h6ac2cab1jbfd9cbcfd02648ee@mail.gmail.com
2988956175-1303914-org-orgdb@bounces.salsalabs.net
2988956175.2101115991@org.orgdb.reply.salsalabs.com
2997974764-1304577-org-orgdb@bounces.salsalabs.net
2997974764.-1166455987@org.orgdb.reply.salsalabs.com
29a61dd16dd14373a6eb1c756a46aac3@garamendi.org
29ff7efa288acd488dd412939d4d1bab114664@aufc-server.aufc.local
29ff7efa288acd488dd412939d4d1bab114665@aufc-server.aufc.local
29ff7efa288acd488dd412939d4d1bab80e8b9@aufc-server.aufc.local
29ff7efa288acd488dd412939d4d1bab9779e7@aufc-server.aufc.local
29ff7efa288acd488dd412939d4d1bab977c35@aufc-server.aufc.local
29ff7efa288acd488dd412939d4d1baba3f2ea@aufc-server.aufc.local
29ff7efa288acd488dd412939d4d1babad7ce6@aufc-server.aufc.local
29ff7efa288acd488dd412939d4d1babad838b@aufc-server.aufc.local
29ff7efa288acd488dd412939d4d1babd640f3@aufc-server.aufc.local
2cc682b69667672e8649e970ea149cd6@bounce.bluestatedigital.com
2d03b004af224ec2975e51d221c6ac40@cbivex01eus.cov.com
2d0a1834-c13a-4d5d-b93d-c1bdc5fcee70@washpost.com
2d59cac6-0b10-4055-a660-b889d81502f2@xtgap4s7mta4370.xt.local
2d9bf548d5515f438b3aa0b0be7bf5f62f72e9bc19@mbx-01.ptt.gov
2d9bf548d5515f438b3aa0b0be7bf5f6303139b71e@mbx-01.ptt.gov
2d9bf548d5515f438b3aa0b0be7bf5f6303403e632@mbx-01.ptt.gov
2d9bf548d5515f438b3aa0b0be7bf5f6303bd93de6@mbx-01.ptt.gov
2dacc9ba4a3783a18d48365e8cfc8c38@mail.gmail.com
2e1f7e590810202107q15580876ve5c6d7dfe3d7530e@mail.gmail.com
2e6b5dbd6f3a441693c05951ccd71b8b@co2pr06mb633.namprd06.prod.outlook.com
2fc65eff0806192247m599771d0y18907ae9518e8662@mail.gmail.com
2fd0e76c5d4dea4497f9b4e90f7c54351e2cf0ee@exvmbx017-2.exch017.msoutlookonline.net
2idefj2mag+6xrsuodzzkkea@mail.gmail.com
2mqwk1aztw@mail.gmail.com
2os18vp-gyvr+mdp9ot57al8w5xmxwv_q@mail.gmail.com
3+sdvonyypc4082bexzxx8i-x_mcrsls6bejdjdw@mail.gmail.com
3003265178-1304869-org-orgdb@bounces.salsalabs.net
3003265178.-181971224@org.orgdb.reply.salsalabs.com
3010045518-1305149-org-orgdb@bounces.salsalabs.net
3010045518.-572257627@org.orgdb.reply.salsalabs.com
305da801-5fa9-4f22-86bc-9f0f0c30971e@gmail.com
307c740b-9c0b-4696-af9f-89e969081835@dixondavismedia.com
312857322-1224785864-cardhu_decombobulator_blackberry.rim.net-991532988-@bxe032.bisx.prod.on
312e18bafef0f286f55124306e854474@mail.gmail.com
31ce476ee30649f99bb30140753e58c3@pogo.org
31edgsw4jc2k3lspukh8dhyulynthps.jvtipnjhtwhpnunvvnslnyvbwz.jvt@groups.bounces.google.com
31vmwtisge8sc4_pklq@mail.gmail.com
3220772716-1317705-org-orgdb@bounces.salsalabs.net
3220772716.-479381394@org.orgdb.reply.salsalabs.com
3245793556-1319890-org-orgdb@bounces.salsalabs.net
3245793556.1330322652@org.orgdb.reply.salsalabs.com
3270acbe4d6fd92afe0bb14272b78394@bounce.bluestatedigital.com
3274e72e0043871fe37f3eb73baa1901@bounce.bluestatedigital.com
32cb38d9-8ef6-4030-9c01-1f9a245951c5@bsgco.com
32f43471-80a8-4bae-9917-465a7ff93055@gmail.com
330176782-1224784251-cardhu_decombobulator_blackberry.rim.net-820336361-@bxe032.bisx.prod.on
3305332755-1325464-org-orgdb@bounces.salsalabs.net
3305332755.939440515@org.orgdb.reply.salsalabs.com
3324441211-1326183-org-orgdb@bounces.salsalabs.net
3324441211.969349661@org.orgdb.reply.salsalabs.com
333086195.1738138.1452119977384.javamail.app@ltx1-app6023.prod.linkedin.com
333528825d84f64694fa3fd9024c489b@namprd03.prod.outlook.com
3337489454-1327963-org-orgdb@bounces.salsalabs.net
3337489454.-1927087893@org.orgdb.reply.salsalabs.com
3342bb12-808c-483d-afa9-a6ae991d9069@clintonfoundation.org
3346110236-1328770-org-orgdb@bounces.salsalabs.net
3346110236.2003754165@org.orgdb.reply.salsalabs.com
33486bc2a41fe9409dcddfd3ed236f21@namprd07.prod.outlook.com
3384553778-1331844-org-orgdb@bounces.salsalabs.net
3384553778.-1860570962@org.orgdb.reply.salsalabs.com
3386672904-1332014-org-orgdb@bounces.salsalabs.net
3386672904.1075177298@org.orgdb.reply.salsalabs.com
3393331108-1332513-org-orgdb@bounces.salsalabs.net
3393331108.1986425355@org.orgdb.reply.salsalabs.com
3397615fbdd64a53a17f9d83f0316015@jayfootlik.com
3400946676-1332932-org-orgdb@bounces.salsalabs.net
3400946676.1349888421@org.orgdb.reply.salsalabs.com
3403294676-1333143-org-orgdb@bounces.salsalabs.net
3403294676.342197911@org.orgdb.reply.salsalabs.com
3413292803-1333798-org-orgdb@bounces.salsalabs.net
3413292803.-977009124@org.orgdb.reply.salsalabs.com
34bdff4b04e0bd733083c2b873873da5@bounce.bluestatedigital.com
350682666-1224196300-cardhu_decombobulator_blackberry.rim.net-341914585-@bxe252.bisx.prod.on
354ca8046455494b9a6c757586bb2ebf@namprd03.prod.outlook.com
359739553-36691-wfc2-wfc2db@bounces.salsalabs.net
359739553.-524971464@wfc2.wfc2db.wiredforchange.com
35e1cb1e-25e6-4843-bfd5-7d93076eeb43@gmail.com
3678456b-d062-4982-a692-6585cd2580ed@gmail.com
3683dabc03eadd352e2cacc6e4e6cb65@mail.gmail.com
36c48de8239770148b317d5a0fbd0ed098e.20151119171326@mail20.suw15.mcsv.net
3730200246e7bb42ad5716159c1c4c0c@exchange.mit.edu
379375554.314610551.1434812486980.javamail.root@sjmas01.marketo.org
37aab604f5108dba4bb621cc286b9e8f@bounce.bluestatedigital.com
3809cbbcdaa83d4b9046701c3b8807316f02ca@evs1.hillaryclinton.local
38dc900846b5f9438e7f2309cfad075c@namprd03.prod.outlook.com
390458988-40425-wfc2-wfc2db@bounces.salsalabs.net
390458988.1123179565@wfc2.wfc2db.wiredforchange.com
391db2d2e5138b43aa28b750d2d0789601369b06@evs1.hillaryclinton.local
391db2d2e5138b43aa28b750d2d078960296faae@evs1.hillaryclinton.local
391db2d2e5138b43aa28b750d2d0789602d62a29@evs1.hillaryclinton.local
391db2d2e5138b43aa28b750d2d0789603c750fa@evs1.hillaryclinton.local
391db2d2e5138b43aa28b750d2d0789608de675c@evs1.hillaryclinton.local
392d5add-6ace-468e-8b22-25362d572d9b@alumni.stanford.edu
39b1193a6bd9af44a6a516f49c92315f09c192b3@cn-399-exch2.whca.mil
39b59aa21662044e8fca4351ea5c1096@namprd03.prod.outlook.com
39dopswkjcx0fdlm7gs7e9f3be.5hf4b953fi3b9g9hh9e79khnil.5hf@groups.bounces.google.com
3a1ecbf29d41c34cb0bdadd757540d09139c9a2290@clinton07.utopiasystems.net
3a1ecbf29d41c34cb0bdadd757540d09139c9ed63c@clinton07.utopiasystems.net
3a1ecbf29d41c34cb0bdadd757540d09139d121c01@clinton07.utopiasystems.net
3ab289d5-639a-4e0a-af4d-b51387d9e3d7@me.com
3arbgfcik66zyp3x8ykjrypl9095ur5y2g@mail.gmail.com
3b00efa99369c540be90a0c751ef8f8a01296af9@sf-exch01.sandlerfamily.org
3b00efa99369c540be90a0c751ef8f8a0137bbd5@sf-exch01.sandlerfamily.org
3b00efa99369c540be90a0c751ef8f8a13ec1738@sf-exch01.sandlerfamily.org
3b00efa99369c540be90a0c751ef8f8a473d41@sf-exch01.sandlerfamily.org
3b00efa99369c540be90a0c751ef8f8a4e8b79@sf-exch01.sandlerfamily.org
3b00efa99369c540be90a0c751ef8f8a52b805@sf-exch01.sandlerfamily.org
3b378138-60ad-423f-b28c-d3dd7ffc4e60@mit.edu
3b4c5ef113aa5861cd940920b432823f@bounce.bluestatedigital.com
3b6181c98933ae32b0544a2418f037b2@mail.gmail.com
3bcfd09f830982fe1d21c3d94ce13651@mail.gmail.com
3bf02b3e4640304b832d6c4a30c6b655@namprd03.prod.outlook.com
3brscottlilly@hotmail.com
3c3010598fe52c84892d52ebf0cad426@mail.gmail.com
3cda85d8-0b11-4403-9a87-d1a7c664a0a2@ibtimes.com
3cec9755f6867a10d6a9b1e5d2cf6b1d@mail.gmail.com
3d4e0dab0236644193f6aa291205b23b045420ad@sdcpexccl2mx.wilmerhale.com
3dcbc2b3-e620-4cb2-9676-f5005c3747bd@me.com
3dcenterpeace.org@mail128.wdc02.mcdlv.net
3dcenterpeace.org@mail13.atl161.mcsv.net
3dcenterpeace.org@mail130.wdc02.mcdlv.net
3dcenterpeace.org@mail146.atl21.rsgsv.net
3dcenterpeace.org@mail147.atl61.mcsv.net
3dcenterpeace.org@mail155.atl171.mcdlv.net
3dcenterpeace.org@mail164.atl171.mcdlv.net
3dcenterpeace.org@mail164.atl61.mcsv.net
3dcenterpeace.org@mail169.atl171.mcdlv.net
3dcenterpeace.org@mail172.wdc02.mcdlv.net
3dcenterpeace.org@mail175.atl81.rsgsv.net
3dcenterpeace.org@mail183.atl81.rsgsv.net
3dcenterpeace.org@mail186.suw14.mcdlv.net
3dcenterpeace.org@mail188.atl21.rsgsv.net
3dcenterpeace.org@mail190.atl171.mcdlv.net
3dcenterpeace.org@mail191.atl121.mcsv.net
3dcenterpeace.org@mail191.wdc02.mcdlv.net
3dcenterpeace.org@mail192.wdc02.mcdlv.net
3dcenterpeace.org@mail20.us4.mcsv.net
3dcenterpeace.org@mail200.suw14.mcdlv.net
3dcenterpeace.org@mail208.atl171.mcdlv.net
3dcenterpeace.org@mail215.suw16.rsgsv.net
3dcenterpeace.org@mail217.atl21.rsgsv.net
3dcenterpeace.org@mail222.atl21.rsgsv.net
3dcenterpeace.org@mail3.wdc03.rsgsv.net
3dcenterpeace.org@mail34.atl71.mcdlv.net
3dcenterpeace.org@mail34.suw17.mcsv.net
3dcenterpeace.org@mail36.wdc03.rsgsv.net
3dcenterpeace.org@mail38.atl11.rsgsv.net
3dcenterpeace.org@mail42.suw15.mcsv.net
3dcenterpeace.org@mail44.suw15.mcsv.net
3dcenterpeace.org@mail46.atl71.mcdlv.net
3dcenterpeace.org@mail48.suw11.mcdlv.net
3dcenterpeace.org@mail53.atl31.mcdlv.net
3dcenterpeace.org@mail54.atl51.rsgsv.net
3dcenterpeace.org@mail65.suw15.mcsv.net
3dcenterpeace.org@mail66.atl31.mcdlv.net
3dcenterpeace.org@mail68.suw11.mcdlv.net
3dcenterpeace.org@mail69.atl31.mcdlv.net
3dcenterpeace.org@mail69.suw11.mcdlv.net
3dcenterpeace.org@mail7.atl161.mcsv.net
3dcenterpeace.org@mail71.atl111.rsgsv.net
3dcenterpeace.org@mail75.suw11.mcdlv.net
3dcenterpeace.org@mail77.atl11.rsgsv.net
3dcenterpeace.org@mail82.suw11.mcdlv.net
3dcenterpeace.org@mail82.suw15.mcsv.net
3dcenterpeace.org@mail9.atl71.mcdlv.net
3dcenterpeace.org@mail90.atl161.mcsv.net
3dcenterpeace.org@mail90.suw11.mcdlv.net
3dcenterpeace.org@mail93.atl71.mcdlv.net
3dcenterpeace.org@mail96.atl161.mcsv.net
3dcenterpeace.org@mail98.atl71.mcdlv.net
3dcenterpeace.org@mail99.atl11.rsgsv.net
3dcenterpeace.org@mail99.atl51.rsgsv.net
3dclyde2016.com@mail143.atl101.mcdlv.net
3ddemocracycorps.com@mail210.atl21.rsgsv.net
3ddevinemulvey.com@mail182.wdc02.mcdlv.net
3dgmail.com@mail18.wdc01.mcdlv.net
3dgmail.com@mail189.suw16.rsgsv.net
3dgmail.com@mail20.suw15.mcsv.net
3dhalifaxtheforum.org@mail131.atl171.mcdlv.net
3dhalifaxtheforum.org@mail24.atl91.mcsv.net
3dhudson.org@cmail1.com
3dhudson.org@cmail19.com
3dhudson.org@cmail2.com
3dhudson.org@cmail20.com
3djohn.podesta@gmail.com
3djohnpodesta@gmail.com
3djoshschwerin@gmail.com
3dkianderson@nea.org
3dpodesta@law.georgetown.edu
3dslilly@americanprogress.org
3dsyr.edu@mail152.suw16.rsgsv.net
3dsyr.edu@mail25.suw17.mcsv.net
3dthecommongood.net@mail141.wdc01.mcdlv.net
3dthecommongood.net@mail151.atl171.mcdlv.net
3dthecommongood.net@mail168.atl101.mcdlv.net
3dthecommongood.net@mail170.atl171.mcdlv.net
3dthecommongood.net@mail171.wdc02.mcdlv.net
3dthecommongood.net@mail182.atl101.mcdlv.net
3dthecommongood.net@mail187.atl101.mcdlv.net
3dthecommongood.net@mail199.atl101.mcdlv.net
3dthecommongood.net@mail211.suw14.mcdlv.net
3dthecommongood.net@mail215.atl61.mcsv.net
3dthecommongood.net@mail22.us4.mcsv.net
3dthecommongood.net@mail23.us4.mcsv.net
3dthecommongood.net@mail34.atl91.mcsv.net
3dthecommongood.net@mail39.atl31.mcdlv.net
3dthecommongood.net@mail39.atl71.mcdlv.net
3dthecommongood.net@mail40.atl111.rsgsv.net
3dthecommongood.net@mail44.atl111.rsgsv.net
3dthecommongood.net@mail46.atl11.rsgsv.net
3dthecommongood.net@mail55.atl111.rsgsv.net
3dthecommongood.net@mail56.atl51.rsgsv.net
3dthecommongood.net@mail6.us4.mcsv.net
3dthecommongood.net@mail72.suw15.mcsv.net
3dthecommongood.net@mail8.atl31.mcdlv.net
3dtheskimm.com@morning1.theskimm.com
3dtheskimm.com@morning2.theskimm.com
3e37bc2d23654940b2c131740a38e74106d27d4c@mbx025-e1-nj-4.exch025.domain.local
3e56506515893b45bfb599ebd186c1c48c870cec54@cortez.ucdenver.pvt
3eab93dc-da2e-4574-bd6d-96995895dfb6@gmail.com
3ee82e4a-7a9a-4501-b623-7c6f14ffb7ae@gmail.com
3f78bf3b-7398-4662-a814-87253e356d95@bsgco.com
3fdbb7a04efbb2bc6221e2d8d13d7650@mail.gmail.com
3g1hsswsncyshispjrzalpuuzuladvyr.vynipnjhtwhpnunvvnslnyvbwz.jvt@groups.bounces.google.com
401bf6a473eda042a5e7a839ccaae48e15123fde30@clinton07.utopiasystems.net
403690a1-965b-475f-a748-8f6b24ba827b@xtnvmta4102.xt.local
409a88010d19f5c23e606f7a0283462a@mail.gmail.com
414bc7cb-bf89-4d18-82b8-0f01b59118ef@bsgco.com
417be.4ab17274.3a49169f@aol.com
41d5d46b7a789b479a4d5bfea4d4089b@namprd03.prod.outlook.com
41f9ed63-bb73-4107-803a-23c81d634127@aol.com
4231752cbb1f1845bab3514c8bda8f21@exch028.domain.local
4291f3d8-97ad-49cc-86bb-442ea67a0c78@aol.com
42a1a76c-ef53-4274-8673-7d51645f067a@gmail.com
42ccf0c5a2cb264aadca5436067e62cf@namprd03.prod.outlook.com
42f8899c-93b8-4daf-b765-b3533e1d90e3@bsgco.com
43aa882b9390f2428f6563c1c95b58c3185171bc@law-mbx02.law.georgetown.edu
43aa882b9390f2428f6563c1c95b58c3185171cb@law-mbx02.law.georgetown.edu
43dda9eef35c4908a659fd17926c8b3d@co1pr07mb313.namprd07.prod.outlook.com
4461249db47dee4e801eed0e1b97091959933ba7@msgexsv21124.ent.wfb.bank.corp
449191bb484d49ccb8f0d89a3c700105@nancyroteringforcongress.com
4494ef4ea19f2c42a119fa515a9d29983c644680@bl2prd0512mb613.namprd05.prod.outlook.com
453914891.316353132.1445031872180.javamail.root@sjmas01.marketo.org
4569b3c70805140900o4836f0a0rb6772c472a4dba3a@mail.gmail.com
4569b3c70805151054u5e7635b1t3cc6127272a6c112@mail.gmail.com
4569b3c70805230933r4a422e36ne36a05a109f10bda@mail.gmail.com
4569b3c70806021817v428dd667y8f10c853e456f09d@mail.gmail.com
4569b3c70806051924o394297a3gcff2cd60fb9e7c9c@mail.gmail.com
4569b3c70806061850ie0e8fd1yc82e9251c20386b4@mail.gmail.com
4569b3c70806092006o492f85ddk6756e169feb4b420@mail.gmail.com
4569b3c70806151044l27e6fdffvd359dd7afde09c97@mail.gmail.com
4569b3c70806162003h6fa240d4ha27c0ba3d5f5e373@mail.gmail.com
4569b3c70806201908o42df0a49odd008a9426fb84df@mail.gmail.com
4569b3c70806230521r3bfbcd95x71f43beaabbbbc0d@mail.gmail.com
4569b3c70806240524n229056e8s30102557353c5dbe@mail.gmail.com
4569b3c70806250520p2bd6d886xdb23a3fbef026617@mail.gmail.com
45e83fa2fc991f4995a99f6885e583c70a03a6c0@cn-399-exch2.whca.mil
4623a98d-c9a5-43f1-b9d2-fcf3c92930c3@hrcoffice.com
469171126.493396.1443795149585@n7umgw26.starwave.com
46c73dd1-fe0b-42c0-a73c-117ea0e3bf8b@news.ap.org.jpg
471977a42edc36af4fc047bde1fbfa25@mail.gmail.com
47294d9b51ec4d9393386e39f9013605@co1pr07mb313.namprd07.prod.outlook.com
47@hillaryclinton.com
47bb2d0d7087e8a32d656ad092bbf49d@bounce.bluestatedigital.com
47cc98d84dba6749965d209949e3e5f5@namprd03.prod.outlook.com
4811f1f7-4b4f-4259-be73-7f2cbfe3276e@opensocietyfoundations.org
492b7e9b-256a-4472-a712-e1f8c542e8f7@mit.edu
4948a2ba0807130825ncc8e2dbm63397c2b0354d13@mail.gmail.com
4948a2ba0808050751x75af7305v5913d2e2b3f175c0@mail.gmail.com
4948a2ba0808051054i47339bqebb35f2f6c5bbbbd@mail.gmail.com
4948a2ba0810072050l1f845610x17c526d5fec6399d@mail.gmail.com
49641d4f-4477-44b6-9618-2ca9818a0ad1@americanbridge.org
498e01d946934e15aed06f2c740d05ae@mail.gmail.com
49e4a6c3f56048b8a5bdcdfd3cfdba78@nancyroteringforcongress.com
4a1a0dda-57ce-4534-8f9f-7198c3686f1a@gmail.com
4a1de084.100bca0a.26f1.73e9smtpin_added@gmr-mx.google.com
4a690ba92801374689b1d958b8163e770275a56df3@clinton07.utopiasystems.net
4ab660c9-7d83-4c98-9d57-b1ed4d128445@gmail.com
4ad0282a-a6b6-42c8-956c-8d306fb3c992@law.georgetown.edu
4b771a373f6b0c4e9c1f9959fb8e5205@fleishman.com
4b7aed03c80a00a2ae42609852548e10@bounce.bluestatedigital.com
4b8964709f5c044099e74d7f0f861f83@namprd03.prod.outlook.com
4ba8faae.2bba.0066.0@nwa.org
4ba8faf8.2bba.0066.0@nwa.org
4c2b972e-02e1-4033-b1ae-beb4618ce352@gmail.com
4c4a2e6b7ba7ae41899de9963c1c8bc6067f2ecb@nea-hq-evs2.nea.loc
4c4a2e6b7ba7ae41899de9963c1c8bc6d364b6@nea-hq-evs2.nea.loc
4c666ebf-a3f2-49d1-a923-aecde2bd4f43@gmail.com
4cd37e40-764a-4100-9093-ce5f4a67083c@gmail.com
4dx95mtzt1xnfsmkqukzmr47dpq@mail.gmail.com
4e8af7970807111214ve23b3f7j679bda08f6144966@mail.gmail.com
4ea@mail.gmail.com
4ecb677e-4dcb-4546-8858-5ac655e86c60@presidentclinton.com
4ee45d0a8acb1e0a32e66135fc5759f2@mail.gmail.com
4f0e7974-6d0c-4d52-b38b-9015caca327c@progressivemediausa.org
4f1437da-7317-40ad-aeca-df43fb17d47f@aol.com
4f81391a-e771-4905-a20a-57cb0c4b7fad@gmail.com
4mnkwff_dxpktadyixvabnla@mail.gmail.com
4q@mail.gmail.com
5.021407e6@mail.abanet.org
5065cbd5-3255-47f3-ae00-be96fa6597f4@aol.com
507ca52a38821e469488a713cb424a77@namprd03.prod.outlook.com
50cfcb436f489_2dcc621e347181e@worker2.nbuild.3dna.managedmachine.com.mail
50cfcb437022e_2dcc621e3471987@worker2.nbuild.3dna.managedmachine.com.mail
50cfcb43709e0_2dcc621e3472089@worker2.nbuild.3dna.managedmachine.com.mail
50eb67e61877_314fbe9e34100350@worker4.nbuild.3dna.managedmachine.com.mail
50eb67e62539_314fbe9e34100418@worker4.nbuild.3dna.managedmachine.com.mail
50eb67e62cce_314fbe9e34100540@worker4.nbuild.3dna.managedmachine.com.mail
5100a4b6ca9bd4408d0fea4c2bcdc5c3@undp.org
516fe478-b502-4a04-a336-57d18e0ad1b5@albrightstonebridge.com
525f9d6f624a684d8bf95af3627b341c@law.georgetown.edu
52b3c703efb9a34793bd5481f5b3cf41@law.georgetown.edu
5359f071-8af9-4194-9606-597d78d77b6c@bsgco.com
536aaea90805160800j77c8efd3ge35a07cbdf952416@mail.gmail.com
536aaea90806031655j6309642dm4e1bc2ac92c7685a@mail.gmail.com
536aaea90806031814v4085e1beja690bbbcefdd67b3@mail.gmail.com
53d5ed1a-d586-40ce-bbc4-10f1e6eb33d2@mit.edu
53e160ac.9060708@t-online.hu
54c50bc8-c20b-477c-8b78-42e6e5b24e39@gmmb.com
551534ad.60836b0a.5388.227csmtpin_added_missing@mx.google.com
554d0cca.2307320a.3c01.5480smtpin_added_missing@mx.google.com
5556647df8c0be7cf0da07db23596deea0c.20140905205642@mail9.atl91.mcsv.net
5556647df8c0be7cf0da07db23596deea0c.20151014182542@mail157.atl171.mcdlv.net
55807659.cb592a0a.50d8.2e4fsmtpin_added_missing@mx.google.com
55c1ebac.0000000a@pmta01.ewr1.nytimes.com
55c33d3f.00000a9a@pmta01.sea1.nytimes.com
55cb256e.00000cb2@pmta04.ewr1.nytimes.com
55d30f50.000007ba@pmta04.sea1.nytimes.com
55d45ffc.000006c7@pmta01.ewr1.nytimes.com
55d7055e.000008f9@pmta04.sea1.nytimes.com
55daf81c.00000e50@pmta04.sea1.nytimes.com
55dce66dbfc3814682135569d472fc73@exchange.mit.edu
55e03cc3.0000059c@pmta02.sea1.nytimes.com
55e583c5.00000cfc@pmta04.sea1.nytimes.com
55e82b6f.0000009c@pmta04.ewr1.nytimes.com
55e97b38.00000dfd@pmta02.ewr1.nytimes.com
565454a5.00000763@pmta02.ewr1.nytimes.com
5678a18b0804220926o6c7a049s8e7f7829cc16468f@mail.gmail.com
5678a18b0805121352v3f32f544t1f4d113796476c53@mail.gmail.com
5678a18b0805131554x1f74fd1cp14312e0f79d77bab@mail.gmail.com
5678a18b0805201055h36e282aambd713c486c078def@mail.gmail.com
5678a18b0805222046g1c059195g5f273dac4506a326@mail.gmail.com
5678a18b0805271057s1808059co714cb991bb0ce7e7@mail.gmail.com
5678a18b0805271112j30461b0fn5c53266ef81c3e71@mail.gmail.com
5678a18b0806021448w537ee0d1qa2fdf70cff4d890@mail.gmail.com
5678a18b0806121220g3d2685d7xd97e87352843353f@mail.gmail.com
5678a18b0806121704t629a108el48fac965d1f419df@mail.gmail.com
5678a18b0806171511g6d1292e4t262d2bf7b8bbecb8@mail.gmail.com
5678a18b0806191924h1dfc6fc1t5c1b72911886f673@mail.gmail.com
5678a18b0806201037r748ea8ccmf9fb6759b4f8bbf6@mail.gmail.com
5678a18b0806231145l2a2378a5j66cb943acabfad59@mail.gmail.com
5678a18b0806241038m73167f05y4e7cd55c9e793c8c@mail.gmail.com
5678a18b0806251122q4fbbdf23q7135b3ab111f95dc@mail.gmail.com
5678a18b0806270837r1bcf416dsd0571e901070cec4@mail.gmail.com
5678a18b0806280851y402b5e3bn267786361c0f9fe5@mail.gmail.com
573519550907071647w368ebfd4yfa65d2433239e1d7@mail.gmail.com
579457e4-e490-4adf-817b-6c9f207d5f9a@xtgap4s7mta4362.xt.local
57e1419c-cd29-4f8f-96c2-a7b5beed9a78@americanbridge.org
58311617dff0630987e9f2b208a9bf31@mail.gmail.com
58a6bb60-2e4e-4535-a640-1d26214e932f@bsgco.com
58bcf0c2856ec4704e503314df8acb29@mail.gmail.com
58c8fe7b-8102-47f4-8316-ae3c5901c636@progressivemediausa.org
58c9d10286c6f34e88a4de1c424342a804c96c6fa0@sm-nyny-vxmb03a.nena.wdpr.disney.com
5968b577-58a5-4b2c-97e2-7ef3e5937914@podesta.com
59ba71692c7205362209ef77c52a8b31@mail.gmail.com
5@gmail.com
5a195da6a7d4e24e92440054dd58d60c@namprd03.prod.outlook.com
5a351eb4-0ec4-4160-9b04-0d89ac8bdda9@algpolling.com
5a@mail.gmail.com
5aigc9ptrrdbkbckouwkr_u-sbzdlrq0mfeda@mail.gmail.com
5b05ygcb+gakw@mail.gmail.com
5byzl-lo1twgfoh-dqyhrxtdw47e_7kk8y4kn_1_fda@mail.gmail.com
5c59b899-0644-40a3-8225-3a340115638f@americanbridge.org
5c7df3ab4a71ac448f7f63603ebdc6d6@fleishman.com
5c919f43d8ac5e4bbed2d67d6af82e24@namprd03.prod.outlook.com
5c9d9cb18adccd47b19508c540c0afb0809825f5@alxmbx02.gibsondunn.net
5c9d9cb18adccd47b19508c540c0afb080982b99@alxmbx02.gibsondunn.net
5c9d9cb18adccd47b19508c540c0afb0809ae64a@alxmbx02.gibsondunn.net
5c9e3d1c3ffbb6ab3b30576b3246d3dd@mail.gmail.com
5cbc753c-d282-4ed4-bd7a-7d774ebe9455@corridorpartners.com
5cetlcnxflvv3b1bgke9kga1_ic8lxjeayjzwoglmv4a@mail.gmail.com
5cfb44d64a78ca459d19be4b86c9f9e825587e02@law-mbx01.law.georgetown.edu
5d1526952651004b89c39065c16d7c54@exchange.mit.edu
5dwknjdg3ueq@mail.gmail.com
5e0ad184d744bbdfbaa08040594dca30@mail.gmail.com
5e57203aa3166e4f8e292df8af1076a2@namprd03.prod.outlook.com
5e5cb08a0809240727v59044ed6h5020c03694a0a91c@mail.gmail.com
5e5cb08a0809241155w6d14e87ci969c26c33cc2f481@mail.gmail.com
5e5cb08a0809241219r7e3e57bq707a8442c670228c@mail.gmail.com
5e8a0f94-b5bb-4f92-8a5f-5ca9ff0bede8@podesta.com
5e9vkfmtuusgx-mtw3h-cg9cnpv2j2pzq@mail.gmail.com
5ebfba04-a4e2-45fd-a976-d48a77d975a1@oceanunite.org
5efca6dc9936dd4a9d67681294983ac7@exch031.domain.local
5f703efb19b6605723b85b52270d29f1@bounce.bluestatedigital.com
5f70ffd4b3fd23d9639bdcbf3226344b@mail.gmail.com
5fb7a004-a800-4ffb-83c8-f7b46403757f@q26g2000prq.googlegroups.com
5fc77703022c43f1be28106dbd5638ba@iowadailydemocrat.com
5fee8be00907071719g1404a383k161fe7839e4f136c@mail.gmail.com
5osy_xjx0q2ctmrzbcpbkaafao_xcyzppo9okncmydig@mail.gmail.com
5r50thx2ifpmun4d3qfsfzyrjadnqhsou495ryhbz_cg@mail.gmail.com
6-acfe-41b1-b681-da8ded2581f6@hsd1.co.comcast.net
602e00a1-b375-4b20-91e0-0287cdeb9313@podesta.com
607437877.379650064.1435152398248.javamail.root@sjmas01.marketo.org
60f9a2ae-fa03-42c6-abe9-cb970cea3b05@me.com
62465cf0064e2247afa2fff9ef87687b207493a7@usaoaemwp014.mail.tfayd.com
62da25c9-0fda-4c2a-87f9-5aa8f8b7de6f@me.com
638c7377c492e64881a8a25071fa3fb4@namprd03.prod.outlook.com
63aa36ba-1e01-435f-82cd-ef78c79c6f6e@xtgap4s7mta4376.xt.local
63f16f6e7461e413ee2fb9db017bae0d@mail.gmail.com
645b0e7e-e4b5-47ed-8618-8e87131f8bd8@gmail.com
64a69051-e343-4a9a-96ac-e6c03229fe83@gmail.com
64d8c2b996cd9c41872b36642d3fd944@namprd03.prod.outlook.com
64fcbb70-f20a-4daa-a282-877abd0563d5@gmmb.com
651edfb72078454697df67586425910e1491366f4f@clinton07.utopiasystems.net
651edfb72078454697df67586425910e14913678ac@clinton07.utopiasystems.net
651edfb72078454697df67586425910e1497b187f1@clinton07.utopiasystems.net
651edfb72078454697df67586425910e17b8d9b2db@clinton07.utopiasystems.net
651edfb72078454697df67586425910e17b8eb81ee@clinton07.utopiasystems.net
651edfb72078454697df67586425910e17dfa6b008@clinton07.utopiasystems.net
651edfb72078454697df67586425910e17dfac1386@clinton07.utopiasystems.net
651edfb72078454697df67586425910e17e1905532@clinton07.utopiasystems.net
651edfb72078454697df67586425910e17e1905535@clinton07.utopiasystems.net
651edfb72078454697df67586425910e17e1ac632c@clinton07.utopiasystems.net
651edfb72078454697df67586425910e17e1ac6de3@clinton07.utopiasystems.net
651edfb72078454697df67586425910e17e1ac6de7@clinton07.utopiasystems.net
651edfb72078454697df67586425910e17e32a7611@clinton07.utopiasystems.net
65434b63750dce4b9c965f5c898f8515@cdsmail.pvt
655e5a96-f4c9-4f5c-9e42-1eab6ce677f9@gmail.com
667008378439441ea21eeccc193da65e@kslawmail.com
66788f54-3c55-4813-8bb3-f68c9616fda0@gmail.com
672d06d9-88da-4bb2-9cef-97fe3a8a1ce3@gmail.com
6772f65f-4c17-4761-b40c-fb0e98d97dcc@gmail.com
67ba043f-e5b1-4e85-9c4d-2505d54f38ab@mit.edu
6858bb6a0807161009h41a8bfa7j49ae9060fdc19208@mail.gmail.com
6858bb6a0807170925h2ca32642x9787122c27c0f7be@mail.gmail.com
6858bb6a0807181040w2fdf4440v40d0a73d9067c2d6@mail.gmail.com
6858bb6a0807181044q2eff0eb4xbbbeebe6f79a44c9@mail.gmail.com
6858bb6a0807211004s192841a5yd3e4f9c44dac0d6b@mail.gmail.com
6858bb6a0807220834u7cda400ej3717ae57abe8e545@mail.gmail.com
6858bb6a0807220840k36fe15b5q4833d3fbbcd8fcc0@mail.gmail.com
6858bb6a0807240902s665f6b9cmf5e2f1f0f39fb0da@mail.gmail.com
6858bb6a0807240906y42fd4d06g374ce5124b0027e@mail.gmail.com
6858bb6a0807300832k457e6881ybfefa40642d01614@mail.gmail.com
6858bb6a0807300833i32bc1bfel787a224907081d60@mail.gmail.com
6858bb6a0808121827p2ddd15f5vf832c64a3aa3bb0e@mail.gmail.com
6858bb6a0808121829r7a2e8a36gbc3a5ff8c5cf839e@mail.gmail.com
6858bb6a0808141942o2c85641es5617b090b13629d7@mail.gmail.com
6858bb6a0808141944r7e2f9918mec5f387adbb7490e@mail.gmail.com
6858bb6a0808151932h65a6864eg54b7391ae1af6f@mail.gmail.com
6858bb6a0808171128o1b16124bu7831f497cb520324@mail.gmail.com
6858bb6a0808171132s6771d12gbf9e77f74d42e999@mail.gmail.com
6858bb6a0808191910j2c618421tcdc5a1a19a0be9eb@mail.gmail.com
6858bb6a0808191913r33aa48f9l93f4a1cf0eb73925@mail.gmail.com
6858bb6a0808221911u120c286cw41e3818ede2224d0@mail.gmail.com
6858bb6a0808221916h72bad031r70e5520cc7244ea9@mail.gmail.com
6858bb6a0808260616jae697a7mc1e65cf285ef694@mail.gmail.com
6858bb6a0808260940j67a4e29doe3050490502a0e0b@mail.gmail.com
6858bb6a0808260942m107d5094q1fe5f734e24c0f76@mail.gmail.com
6858bb6a0808270528j699c79e1s1ea4c261ea62e4a9@mail.gmail.com
6858bb6a0808270548u102335d7y78d5581d2971cf30@mail.gmail.com
6858bb6a0808271031w466e9e5ar5b4942b4cea2a58b@mail.gmail.com
6858bb6a0808271033h17b06106qac767ce71aae443c@mail.gmail.com
6858bb6a0808280916p257ee2b7jaf29cdf93071a79b@mail.gmail.com
6858bb6a0808280917m1d882d3fo731187d559bce9d0@mail.gmail.com
6858bb6a0809141057l2831e2b9s758bffd994910aca@mail.gmail.com
6858bb6a0809141100n61436553m4f22ebd4392a84bf@mail.gmail.com
6883479226ce2904101cc4710c165e1e@bounce.bluestatedigital.com
68zxy2kg3tw7apd00bybtrggutxyrw@mail.gmail.com
6@hillaryclinton.com
6a0e7fa14263964286dc7c1aeac312fe@namprd03.prod.outlook.com
6a7194b319bc974a8dea71a7dea53eab316ce711@law-mbx01.law.georgetown.edu
6aca74727825ad40a9f9e347f03a334a0fea60@s2376m14.cdsmail.pvt
6aca74727825ad40a9f9e347f03a334a1252e6@s2376m14.cdsmail.pvt
6b8g@mail.gmail.com
6bb92cddedc21dd5b785038d6e7b67b6@mail.gmail.com
6bbc74e2-6473-48ec-8040-e712b753c639@xtgap4s7mta4374.xt.local
6bf83802b515ff41abdf84c11360a9c84e940f53e2@mail11.interpol.int
6c5arklrbe0uxb40_ffhkq@mail.gmail.com
6d38f30a0c042a78f8ff53ff8754ef4a@mail.gmail.com
6d93cf58a2cda746ad1fadf9f0cf7c57@namprd03.prod.outlook.com
6dba0d82-4cbf-4968-ac21-6ea109f76e3a@hrcoffice.com
6de92f5b-f160-4904-ada5-29ab69523faf@bsgco.com
6e04b37d0810072005w78c9bb3i8b534c938d485b67@mail.gmail.com
6e82186b0810221937y310b93b2i553c6e535b169e14@mail.gmail.com
6e82186b0810221939v40a1e221v21f001ff27421c10@mail.gmail.com
6f0155defcb7a4439a77cc9fe97cd62207f12c81@senate-ms13.senate.ussenate.us
6f0155defcb7a4439a77cc9fe97cd622087c0543@senate-ms13.senate.ussenate.us
6f0155defcb7a4439a77cc9fe97cd622087c0566@senate-ms13.senate.ussenate.us
6f0155defcb7a4439a77cc9fe97cd622087c059d@senate-ms13.senate.ussenate.us
6f0155defcb7a4439a77cc9fe97cd622087c05ab@senate-ms13.senate.ussenate.us
6f0155defcb7a4439a77cc9fe97cd622087c05af@senate-ms13.senate.ussenate.us
6f0155defcb7a4439a77cc9fe97cd622087c05d8@senate-ms13.senate.ussenate.us
6f0155defcb7a4439a77cc9fe97cd622087c05e7@senate-ms13.senate.ussenate.us
6f0155defcb7a4439a77cc9fe97cd622087c080e@senate-ms13.senate.ussenate.us
6f0155defcb7a4439a77cc9fe97cd622088a45cc@senate-ms13.senate.ussenate.us
6f482366-5fdb-49f1-9aae-d08da82d9d04@hrcoffice.com
6f7634bb-3832-4ce3-934d-462e5c65f636@apple.com
6f8ff29062fbacfd785d3f65ebb91b71@bounce.bluestatedigital.com
6fda2a7db69e1b5b05cd7c99f0d37806@mail.gmail.com
6xebqd1j0oi5fxpcxu63-zha-ccjct5x83jqoszradka@mail.gmail.com
6xyely7qy-1b2w3h22gtcrhq3axvjtlf5nzup7hsxwrw@mail.gmail.com
7-60_html-4189601-7204487-50@mail.nbcnews.com
706f6465737461406c61772e67656f726765746f776e2e656475-1920219@senda.ozmailer.com
70eb6494-589f-4580-908f-55e8bc98e016@progressivemediausa.org
712ed53b758cfc4780bb5b7d833d10f0@namprd05.prod.outlook.com
713890abf2379a0ea65d2f132ade51248f9.20150930191848@mail131.atl171.mcdlv.net
713890abf2379a0ea65d2f132ade51248f9.20151116220722@mail24.atl91.mcsv.net
713c47c6-33ec-4ebb-9fd2-54cc61714650@gmail.com
71447086-3f14-4da2-844d-50c483735053@gmail.com
7167cbf9-70f4-4bef-8e0a-88ab74c28b08@aol.com
72033cd21cbe7568d1bbefe2cca71519@mail.gmail.com
7222cf1d-035e-4ac4-88c1-ef475c9f18a2@americanbridge.org
72374eb5d3d04d16a7261d53f90c190b@bounce.bluestatedigital.com
72c41947-47fd-49a8-aaaf-327b01f65888@gmail.com
74-18121-35e09045@genius-network.com
74dd6ac50457f6142961ff9d883229e2@mail.gmail.com
753fae1c71ee1b82b65d99f735d07bda@mail.gmail.com
758296e97dd361b73b0809051d432d45@mail.gmail.com
75b5d5ae-c11b-4211-8519-bdc95681c754@apple.com
75d85cd70805150921v1f550ce7w9d1b97a69a7bbd5b@mail.gmail.com
75d85cd70805150930u531635dfsdface624b2447fca@mail.gmail.com
75d85cd70805161614o734ee2f8v7f36789b5b487c16@mail.gmail.com
75d85cd70806261132i403b5ed1i5bcbcb946791f1bc@mail.gmail.com
75d85cd70806281101o1a2a5fd9j1f4cfdeb6798aca3@mail.gmail.com
7624a245-6772-4b54-bcf0-5036c5ab8ad3@gmail.com
775b0.72e42ea6.3e91f1fe@aol.com
776ea5c1-6fde-4e4e-af17-23590cfce673@gmmb.com
77ffe4980810020848j5b09b6dcsb4e576df86e0fea7@mail.gmail.com
78294033-6ffb-4755-93d8-d01ee104904f@americanbridge.org
786762d781a7ff4fac9060892b40448803493082c7@clntinet08.clinton.local
786762d781a7ff4fac9060892b4044883e49e0f603@clntinet08.clinton.local
79be21d2-b62c-4af0-8a30-22dab556e86d@progressivemediausa.org
7@hillaryclinton.com
7a918ddd-0072-4433-ab9b-6678188bbc2f@apple.com
7b50e743-4e62-4c82-89bd-ca4c2f382817@americanbridge.org
7be8791d-3c4b-4a62-8441-a005cec58099@gmail.com
7c4c4e87df303044a8f0a8e85286871c@cdsmail.pvt
7c9bd301-1339-4e87-9115-4e7e3b706657@aol.com
7ccb2310-433e-48ec-9304-36cbc7987833@presidentclinton.com
7cec5fe1fe8db86633207a269c9b1d76@mail.gmail.com
7d251b40-70be-45cd-a3d7-830ec1f3867a@gmail.com
7d2d9c7b3288be2d2ccc8fde8bee2896@mail.gmail.com
7d80bcd3322aeb4596887047d3742cf9@namprd03.prod.outlook.com
7da0b80275fb764cb91e211c37f76fc0@exchange.mit.edu
7dffa40d-653d-48c2-af6e-e5d883e259e0@gmmb.com
7e886354dca45f4cb82882f2dab4f87f@exch031.domain.local
7f14a0a3-4a60-4ec9-bfeb-ca483eafb141@hrcoffice.com
7f60a9e9-09f9-474b-8244-b1556dd07a11@bsgco.com
7f65e90c0905260934r54abbebds58a133bbd310091b@mail.gmail.com
7f65e90c0905260935m372534c4x3695ed56dc913ca@mail.gmail.com
7f65e90c0906261036g69924727q4d4e91f8732a406f@mail.gmail.com
7f65e90c0906261037m463ce66aw3f177758cb54998@mail.gmail.com
7f65e90c0908021527q71fb1b35r281eae9f064f98d0@mail.gmail.com
7f8ee-2b4-55036c2e@list.progressohio.org
7fa97bb97e905b4ba304d021fbce98b3@exchange.mit.edu
7m2crg@mail.gmail.com
7rcmlgr1fygpcxkcnmpru_1q7tq_7f+d93s4bzsrmycg@mail.gmail.com
7sku6qxyaxemzrkw8pa7pf3kp071mkpy5no33qvbsa3sjda@mail.gmail.com
7wtlpy+skog@mail.gmail.com
7xnu2ms2vmecbt-kramit1ror60yoa4hvcwpkh866aeg@mail.gmail.com
800590786.789818662.1414513984917.javamail.root@sjmas02.marketo.org
802195.42251.bm@omp1018.access.mail.bf1.yahoo.com
802e4e47-4578-4214-96ac-c80011123b26@me.com
80433f04-0840-47b5-bb55-8eeb267fa63b@hrcoffice.com
80a0c6fbcd6e494e8933d1d1a52d267a0c7e6922@epistula.americanprogresscenter.org
80a0c6fbcd6e494e8933d1d1a52d267a0cf5af0a@epistula.americanprogresscenter.org
80a0c6fbcd6e494e8933d1d1a52d267a0cf5b06c@epistula.americanprogresscenter.org
80a0c6fbcd6e494e8933d1d1a52d267a0cf5b187@epistula.americanprogresscenter.org
80a0c6fbcd6e494e8933d1d1a52d267a0cf5b2a6@epistula.americanprogresscenter.org
80a0c6fbcd6e494e8933d1d1a52d267a0de8c57f@epistula.americanprogresscenter.org
80a0c6fbcd6e494e8933d1d1a52d267a0de8c8ed@epistula.americanprogresscenter.org
80a0c6fbcd6e494e8933d1d1a52d267a0e612878@epistula.americanprogresscenter.org
80a0c6fbcd6e494e8933d1d1a52d267a0e61297e@epistula.americanprogresscenter.org
80a0c6fbcd6e494e8933d1d1a52d267a0ebb4a06@epistula.americanprogresscenter.org
80a0c6fbcd6e494e8933d1d1a52d267a0ebb4d6b@epistula.americanprogresscenter.org
80a0c6fbcd6e494e8933d1d1a52d267a0ebb52b4@epistula.americanprogresscenter.org
80da858c-fafa-484d-abe4-b000b0de6eb9@presidentclinton.com
8101a645a3f876deb6b682bb2f53a2c7.squirrel@ikornapostur.1984.is
8140efec4f075149906dda0b6ffa184859edae@winexc01.sandlerfamily.org
8175117a8b21d34ea213ba867b86ad27@law.georgetown.edu
81af23d72628be4ab76a3aad425923c2@namprd03.prod.outlook.com
829866b097b1162c1db155c90676c5e0@mail.gmail.com
82ac21ab-4ac7-45a0-b64c-8ff253de02ad@presidentclinton.com
82ad9dfe63a803489de25d40769c47cb727f2eb2@law-mbx01.law.georgetown.edu
82d26a9cf17849757e38bf72300b06c6@mail.gmail.com
834d6bfb5f5e2c5fec7c2b55bdc187f2@mail.gmail.com
83838935-4572-4b6e-a21b-479b14bde8c6@aol.com
84b71d51-6e96-47df-8a32-d8417f11e0fb@xtgap4s7mta1361.xt.local
84c7aca5-41c4-426f-8de9-059f451ff850@docs-share.google.com
84d77.4f3f7d0c.3a605310@aol.com
8611f85d-5988-4368-a5a0-899d0a4510b2@xtgap4s7mta4368.xt.local
861fc558ae364b310bce185d1c6008a5@bounce.bluestatedigital.com
86652cebdd5c821806b910cc027686c0@mail.gmail.com
8711303b-3b01-4714-947e-2330450a3d6c@aol.com
87326b31-4b15-4dbb-8a0f-2d35796a7884@aol.com
8743d762-b096-43ac-82c8-85f79603da0e@hrcoffice.com
87906ab90712180741s17b3f4a2n880af756ff516865@mail.gmail.com
87906ab90712210640p64056650g4721e6ade2ff99d2@mail.gmail.com
87906ab90801030813p7866d9b3y7b9532c90bb33a2e@mail.gmail.com
87906ab90802200950t26ecb957gf7ed1c5c35bb14b2@mail.gmail.com
87906ab90808191340k246a3484y1d6655b84c339c16@mail.gmail.com
87906ab90808230716j1423c8a0la69fa310e2e9eb89@mail.gmail.com
87906ab90906171131g13b32a26jdc8a5044e9659903@mail.gmail.com
87906ab90906231309k45cf2fb4m8f29d4ae65a2081c@mail.gmail.com
87a2def0910bf044887f06f84eb9bfaf@namprd03.prod.outlook.com
884917992.106849428.1442594723009.javamail.root@sjmas02.marketo.org
888021441.969102089.1409150304949.javamail.root@sjmas01.marketo.org
88a65344-7de4-410a-84a7-af8392cde388@americanbridge.org
88f4b6b00905061342v74c4d2cyfccb0e339e8a60f7@mail.gmail.com
88f4b6b00905061343r4611883dv6e738d056411c9a5@mail.gmail.com
88f4b6b00905080930o10e19a5h78de82dbac80fe43@mail.gmail.com
88f4b6b00906160929k44a15752p5d1d6537ebe14637@mail.gmail.com
88f4b6b00906160930w71a25ac9r4f11d9e7087d4484@mail.gmail.com
88f4b6b00906160931p466ce48ev5354f6d156882a23@mail.gmail.com
88f4b6b00906230714p745c977dq70807493de0176ed@mail.gmail.com
8968ecba-290d-4a0d-a725-881802caf613@opensocietyfoundations.org
89d5ca58-1666-4c1c-b844-a365dbd52ce7@me.com
89e66d35e7264c14cbcc8ab3912474cc@bounce.bluestatedigital.com
8a3f92340808221533r7ca00d55m123a90fe86829583@mail.gmail.com
8af2c2cd8decd4cc615e95c9b4ea6f7f@mail.gmail.com
8b41ydrcwevebkewjgfw@mail.gmail.com
8c252.1aa2515.3f4fe540@aol.com
8c465e7e78a7104e96e8c9a3f91b79ec@cdsmail.pvt
8c9ba14d-b3d5-433c-9477-06ba87e0d5ac@gmail.com
8cb0f2cf13a8295-5e4-4d7@webmail-mc15.sysops.aol.com
8cb0f2ea1e923e7-5e4-586@webmail-mc15.sysops.aol.com
8cb0f310333f420-5e4-6db@webmail-mc15.sysops.aol.com
8cdb838a0471c31-e8c-d3f3@webmail-m036.sysops.aol.com
8cddeba0fa3661a-f84-f460@webmail-d088.sysops.aol.com
8d00deb8c58bf2f-2030-27a95@webmail-m275.sysops.aol.com
8d416bbaa440c342a32786849bb9060c123f0d5f@sesseevexmb02u.ses.state.sbu
8d7491bb0ff9bf4c9c6e552b3732141dde5cce@pssvr.progressivestrategies.net
8dd172e0807191400n69bfcbd4lb5b0466f463d7681@mail.gmail.com
8dd172e0807221525h7e9a5665y24b38d2d492dc987@mail.gmail.com
8dd172e0808141531t4239906bw3aef6b9b2e1301c5@mail.gmail.com
8dd172e0809241144y61acf539q23c3254a2c80f4aa@mail.gmail.com
8dd172e0809241217m4970dee3l8776db493ab13e65@mail.gmail.com
8dd172e0809241218x64bef13cs2254b07f9f842552@mail.gmail.com
8dd172e0810161510x31de116dpcf1ba555f0a988ab@mail.gmail.com
8e709ac2c8ecf63f2d1826e58ed0fa47@mail.gmail.com
8e73eddeec113bd4c84adec27a0a660b@mail.gmail.com
8ec4c2e26b85914a8d36a27f6d3a9c70249c8d45@law-mbx01.law.georgetown.edu
8ec4c2e26b85914a8d36a27f6d3a9c70249c8d62@law-mbx01.law.georgetown.edu
8f6e216d0807091100r535d0d4fh96b0ad249e90676c@mail.gmail.com
8f6e216d0807101055q455f24cbu28e58fdf6cd27b7d@mail.gmail.com
8f6e216d0808112023p2f8952ebp29a514c7e2ea6379@mail.gmail.com
8f6e216d0808131856t4ad2f43ex27efcd5bfeefaef7@mail.gmail.com
8f6e216d0808131859x52968c22wc7f45e6c04390a8f@mail.gmail.com
8f6e216d0808150859xfa41479uc0f99c7dd76f464f@mail.gmail.com
8f6e216d0808251918o38d4cfcam58a88b4a20ac80d@mail.gmail.com
8f6e216d0808271813o24703061qa6d1896ac8d705ae@mail.gmail.com
8f6e216d0809171137m39aa2d34i17ac6b6461c0f40b@mail.gmail.com
8f6e216d0810231836g5d4c3d43p1ba3d80ecbab84fa@mail.gmail.com
8fe095ad-4340-4dae-bc63-7f4b379c4bfa@clintonfoundation.org
8ffacfb01f35fb4182212f3db2c246fa1418811acd@clinton07.utopiasystems.net
8nj0_cex3xq@mail.gmail.com
8oonzovikw@mail.gmail.com
8wkmdyagkgcctggnay08+d044aufd_wxptoo5mw_4yw@mail.gmail.com
9-+9nemwmrfj4vb0nvzvw1bjqimmdmxwyomo83bg@mail.gmail.com
9048c.1ccf6d2f.426ac70d@aol.com
905energycall+unsubscribe@googlegroups.com
905energycall@googlegroups.com
90f56b5c53f08f49b56290737cad213c@namprd03.prod.outlook.com
910cb91d85487a4b8abb84c45d8175c94826fda5@mbx031-w1-co-2.exch031.domain.local
9167a694-4c83-45c3-98bd-c1bf36fb744a@hrcoffice.com
92276fa0-d094-4774-9035-99e44f26ce68@americanprogress.org
926feb3102fcae8a8da5a6204ed678bf@mail.gmail.com
9270fe310e5226e1a75df575e0f79ed2@mail.gmail.com
92d3939502dab54cad97ad54c43bcd980e3236ce@vx01mbx0001.va-exch.asp
92d3939502dab54cad97ad54c43bcd980e35d086@vx01mbx0001.va-exch.asp
93622.36d8f08b.39d5e1f4@aol.com
9455c723db57e44b8a55be26bc956fa5@exchange.mit.edu
945664879.4527349.1458244422978.javamail.root@townhallmail.com
946a17c9-5d34-482b-92a9-864565e8cbc2@gmail.com
94a7152743115b0d9d3f9551875cbc8d@mail.gmail.com
95afeef8ab22ce4e8ca3f8e6fbcb8cd127063b2271@aufc-s1.aufc.local
95m0baobq@mail.gmail.com
9606c0e032ea5549bfe8a8a09c7cf6b2@namprd03.prod.outlook.com
966127.23210.bm@smtp104.biz.mail.ne1.yahoo.com
96753f6c0805130106g31530088ge4ff4b1c22c06f36@mail.gmail.com
96753f6c0805130110u106c97aeqa4406b8b0bad8ad7@mail.gmail.com
96753f6c0805152122v8e99473h8d81f50e021994f4@mail.gmail.com
96753f6c0805181111v2dad2553j9e8a7bfa0d0b805b@mail.gmail.com
96753f6c0806181021w5b38c828u17e23aff984def1f@mail.gmail.com
96753f6c0806190950p21fbe85dn5af6ea96673880cf@mail.gmail.com
96753f6c0806240835hb8aef5t64961cc4f841a6f3@mail.gmail.com
96753f6c0806260850m137d32f0r4c6d59b89aae7027@mail.gmail.com
96ea2d26-8f36-4719-96d2-38e8c9ef41e0@aipac.org
972d0d56f35f7eabf0e57d7b6dae3b20@mail.gmail.com
97d5fad7a49640f2ba6ce48de3c65bd0@skadden.com
97eb7.1bed4221.3ea6ff25@aol.com
989085814f071a48ab2949e2af69e06b@namprd03.prod.outlook.com
98cc3369d79bb34eb5a33659a0366e82@namprd03.prod.outlook.com
98fehk9db27ygru5pn33ebtf.1453590982522@email.android.com
98hrod17@clintonemail.co
99f9c351-04cf-4061-b878-6119b3ed284a@gmail.com
9a81cc7d-9bee-4f79-b772-e25037951eef@gmail.com
9babb9af-b223-4ca8-84ad-ea2b8851fc19@gmail.com
9c0ca0c6d11d473f80752f8f480d6682@co1pr07mb313.namprd07.prod.outlook.com
9c6edfc0-5a36-44d4-b200-8cf3993018e8@aol.com
9c7cf6e5-6c7c-4446-94e5-9b7919f01a63@americanbridge.org
9c8c75d3fdc9864a8e873fb5adc4a271@exch031.domain.local
9cbfc867-35c0-4236-bbdb-bdc2bd13f2d6@gmail.com
9da174070807190703l2345e4d9oaf0f88ffab3fa110@mail.gmail.com
9da174070807190740kb062997x7a7db2e1df91765@mail.gmail.com
9da174070808010947y62738aaeg8cd06733d093058b@mail.gmail.com
9da174070808261116s614c5bc2kac312d4ad71fb338@mail.gmail.com
9da174070808291051m22d26806v9866ef57e69e993f@mail.gmail.com
9da174070810121549v14d7f4d9i3ba75d483150ca08@mail.gmail.com
9dd99cba6c904bee872fd047db2aeb30@johndouglassforcongress.com
9f2ebc3e5a425ed0c5c78a2a34689270@mail.gmail.com
9f4c6f3446dc1245b88ec48452ee6e0d@namprd03.prod.outlook.com
9fa94ef420e24e913e367784bc2271d0@mail.gmail.com
9fe0a8120807010933qc506544tc8d229f17adb5d12@mail.gmail.com
9fe0a8120807020930w33c637eaw6f217038d020c39d@mail.gmail.com
9fe0a8120807020932i1e9a8122redcd92a15c1a0c5e@mail.gmail.com
9fe0a8120807081149s2c2d66fwe29beb4ce23d4a35@mail.gmail.com
9fe0a8120807111041u76528995o4d1e3016050d9569@mail.gmail.com
9fe0a8120807111045r163bf4b2k6f7aa099b2f1b7e1@mail.gmail.com
9fe0a8120807131240l33e73347o920f9e28a74d9023@mail.gmail.com
9fe0a8120807131242j62392872yd2d8d63bfc5724ea@mail.gmail.com
9fe0a8120807161928v2008d871kd31ecf21f85fc80e@mail.gmail.com
9fe0a8120807161930p72d2462fo88f9e6bac2d9dcf0@mail.gmail.com
9fe0a8120808051940i3240da11ga51f36c0be6cdbc0@mail.gmail.com
9fe0a8120808051943o79b1babsf4cedec3edc80ae8@mail.gmail.com
9fe0a8120808071942o466f7535lea31dc1a3084faf4@mail.gmail.com
9fe0a8120808071944j595dd57fu4cf5f74e5f8ebd32@mail.gmail.com
9fe0a8120808081845y7bf63ec7y5acd72ed623455b2@mail.gmail.com
9fe0a8120808081846h3bb2e89fj9202c6af87648f9a@mail.gmail.com
9fe0a8120808101024x75822d6dh140752cf65b11c1e@mail.gmail.com
9fe0a8120808101026h7e3be550s657468b8ea1a7df2@mail.gmail.com
9fe0a8120808110806r49850620j45330f64894cf132@mail.gmail.com
9fe0a8120808110808k7facca5en2c5382df487aec88@mail.gmail.com
9fe0a8120808120822x6b5d54d6k21befe8883bd5555@mail.gmail.com
9fe0a8120808120824o199f2c0fta6152c6a7c3f4de5@mail.gmail.com
9fe0a8120808130903v64374883l558e04e9841e304@mail.gmail.com
9fe0a8120808130904j11514a5oca8e516383ecfc10@mail.gmail.com
9fe0a8120808140957x7aebe12cs771f16df9974db34@mail.gmail.com
9fe0a8120808140958s7bac0537ne61d43cb5a455e50@mail.gmail.com
9fe0a8120808180846k417e40eas413f304aacb6fba6@mail.gmail.com
9fe0a8120808180847t78c2eebar8fccc4b55c1400f8@mail.gmail.com
9fe0a8120808191003q47a1058cofff252dcb25eeac6@mail.gmail.com
9fe0a8120808191005i4a3a8965he6d199e5d63e0e83@mail.gmail.com
9fe0a8120808292033l62470337iccdd7e706e9a453@mail.gmail.com
9fe0a8120808292035i472d5e58g64c5fd2a61b2619d@mail.gmail.com
9fe0a8120809081205t10d32493w9a50c78a956a2c61@mail.gmail.com
9fe0a8120809081208l14622d3fw7e7ec72a1f584622@mail.gmail.com
9fe0a8120809111000i29efc7c4ke849e9b2c54c9809@mail.gmail.com
9fe0a8120809111001t5bcefd64p8ef4726e723d68bf@mail.gmail.com
9fe0a8120810221856ufbf9fc7yc955b18026378c8f@mail.gmail.com
9fe0a8120810280827q79971ddeof2035bd67a1db803@mail.gmail.com
9fe0a8120810280829o7ceb7b96rab6122134b867b34@mail.gmail.com
9fe0a8120810310748y6c206f64ia72da92229683ea3@mail.gmail.com
9fe0a8120810310815r75377865u6c45ec82d60349f3@mail.gmail.com
9fjzvqmgyaoqcyemh0ghqcfw_e2krfnujs9farxkxa@mail.gmail.com
9gr0o+bsiphgg-kwedhg_ugdcfmnq@mail.gmail.com
9woua@mail.gmail.com
9zxhbxxop7edlc5q@mail.gmail.com
9zzqm7xzfts35+0gz6x55p4mcq@mail.gmail.com
_+nkhq@mail.gmail.com
_-ww7cq263boebrza88yaddq@mail.gmail.com
_0qhmcyv7bpn+g@mail.gmail.com
_5rhakrch+39mc+h5hbkywqca@mail.gmail.com
_5savw@mail.gmail.com
_8c2qh-pa5qarfubo3a+s3qfnzjcbegzweuspdq@mail.gmail.com
_crb0zm3bs8+hag1g@mail.gmail.com
a+8fq@mail.gmail.com
a0ka71hkn4og80zfipuf-u9ren0wzsgosvhb4js21qxq@mail.gmail.com
a0kcrummy@denverpost.com
a16@hillaryclinton.com
a174460a0ecee04d8f19b641d9bd9fc50d1525@ch1prd0510mb379.namprd05.prod.outlook.com
a1e9da65-4cd9-415a-a144-36ffa7d4aad2@xtgap4s7mta4194.xt.local
a2092ac7-d8e6-45f4-8c8b-5b105b979c27@gmail.com
a211f87f-974e-4215-b745-21d6425a07b2@podesta.com
a28459ba2b4d5d49bed0238513058a7f01251d111919@capmailbox.americanprogresscenter.org
a28459ba2b4d5d49bed0238513058a7f0125f226b58f@capmailbox.americanprogresscenter.org
a28459ba2b4d5d49bed0238513058a7f0125f49e76ee@capmailbox.americanprogresscenter.org
a28459ba2b4d5d49bed0238513058a7f012adc1ef4d4@capmailbox.americanprogresscenter.org
a28459ba2b4d5d49bed0238513058a7f012adc1ef535@capmailbox.americanprogresscenter.org
a28459ba2b4d5d49bed0238513058a7f012adc1ef58f@capmailbox.americanprogresscenter.org
a28459ba2b4d5d49bed0238513058a7f012ae09c537c@capmailbox.americanprogresscenter.org
a2b7dcba7d93e13daf20bf8baa64331a@mail.gmail.com
a2cbe12a55124ace886c511896c46a14@mbx03a-iad3.mex06.mlsrvr.com
a33c361e-e01b-4028-889f-86703d794e8e@americanbridge.org
a358f486-5b79-40ff-988b-ce476d63a9e4@gmail.com
a36de94083ec4485e834ea77502d381e@mail.gmail.com
a37af56292f4432fbca6a1fe6b54a115@pogo.org
a4070de8-6f0b-4c32-94aa-1edc07856dc5@aol.com
a443e63c9f99ee8c39555d1a20b0c600@mail.gmail.com
a4a7b1253134456e136b1c030694c31a@bounce.bluestatedigital.com
a4eb422668a1c1edc0c5e39ea6da4963@mail.gmail.com
a5230e3e-4d14-4a90-86db-298c86aa29e9@aol.com
a596446760ec454295a8adec2961a62a0300c8e3@evs1.gqrr.local
a5cfb6e41cfb7346867fa2820d150c5d1dd5a59c@exch-mbx3.bergersingerman.com
a5cfb6e41cfb7346867fa2820d150c5d1dd5a69b@exch-mbx3.bergersingerman.com
a6802be4-e1be-4d91-b5ce-ee438defba91@gmail.com
a6bb364abdfe4e4db27b8680b44579ba@namprd03.prod.outlook.com
a6d3f45cee35f84874b46ff31699adb6@mail.gmail.com
a7fd21c02d515640ab05af6991fbd73429fa0fee@law-mbx01.law.georgetown.edu
a888e62aab7ccd4db73595ded62138b57627981f@law-mbx02.law.georgetown.edu
a888e62aab7ccd4db73595ded62138b57628087b@law-mbx02.law.georgetown.edu
a9874528-df76-46d0-b21a-deb9f87292fb@xtgap4s7mta1377.xt.local
a9e1e468a2b3374f8bb081cf2b013aa24a58860887@onion.mmfa
a9e1e468a2b3374f8bb081cf2b013aa24a59e027ad@onion.mmfa
a9e1e468a2b3374f8bb081cf2b013aa24a5a18275d@onion.mmfa
a@algpolling.com
a@georgetown.edu
a@gmail.com
a@hillaryclinton.com
a@mail.gmail.com
a@podesta.com
aa693a4e14bfc841b3922edf90212fcb@namprd03.prod.outlook.com
aa72d1875985cad5096719c22e0f955e@bounce.bluestatedigital.com
aaa244@law.georgetown.edu
aaron@njdc.org
aas78@law.georgetown.edu
ab2897@georgetown.edu
ab48a30f0811171600p2e7c0fa9x38c455c14a14b0e9@mail.gmail.com
aba2065c-8e30-4fce-a06c-250a62fda2fc@reply.linkedin.com
abaf7d78-fd05-457d-80da-e9681a204306@sandlerfoundation.org
abaumann@gqrr.com
abbilerner.tikkun@gmail.com
abde0289-6830-4915-ab91-260c82604570@clintonfoundation.org
abeauchamp@fwwatch.org
abernath@law.georgetown.edu
abkedin7qvw@mail.gmail.com
ableeker@bpimedia.com
ablickstein@nsnetwork.com
ablickstein@nsnetwork.org
ablinken@aol.com
abuse@cmail1.com
abuse@cmail19.com
abuse@cmail2.com
abuse@cmail20.com
abuse@genius-network.com
abuse@sailthru.com
ac159a38419c733af8442a547e0b57ca@mail.gmail.com
ac2bfd35-629c-4f19-ab0e-f451deccbc0f@mac.com
acanfield@americanprogress.org
acep333@gmail.com
acherny@democracyjournal.org
acich@hillaryclinton.com
acobs@ajc.com
aconnelly@albrightstonebridge.com
acoronel@clintonfoundation.org
activist@cleanwater.org
acy@safecosmetics.org
acyqhzbfs_rng6uhy+g09uozovx-du0jemgyiopqh-rw@mail.gmail.com
ad.dossier@gmail.com
ad0d8a4c-841f-49b4-a854-ee15a27a8403@gmail.com
ad447f09-523a-4152-990e-0ba7f67c53a1@nsnetwork.org
ad9428c3a1424d7cb80acb8eda9b5741@blupr07mb212.namprd07.prod.outlook.com
ad9588ff-4d20-4f95-8e29-abe6fff508c5@gmail.com
adam.ballard1@gmail.com
adam@mintwood.com
adapt-cal@yahoogroups.com
adaptmt@aol.com
adaseating@hillaryclinton.com
adcdc296acc5000884bd420e49f1939d@bounce.bluestatedigital.com
adeocampo@saban.com
adesai@clintonfoundation.org
adley@me.com
admin@thecommongood.net
adrienne.elrod@gmail.com
aelinoff@nsnetwork.org
aelrod@hillaryclinton.com
aer@hillaryclinton.com
af5042ed-a0d0-4db1-b8e7-c41b020dc99d@xtgap4s7mta4372.xt.local
afauvre@thealbrightgroupllc.com
afd316d5175b5f458c61a02f735c8bf7@namprd03.prod.outlook.com
afeldman@kindsnacks.com
afrancisco@pogo.org
africafocus@igc.org
agendaproject.org@mail.salsalabs.net
ahaviah_glaser@rockefeller.senator.gov
ahitchcock@barackobama.com
ahornbrook@hillaryclinton.com
ahxbdwcfadbd9safwfeqimdezsjcvdcdiswfjpw@mail.gmail.com
aip1zv0dk2sdtlwxyk-q@mail.gmail.com
aisrael@centerforfoodsafety.org
aj.lenar@gmmb.com
aj66@nyu.edu
ajentleson@americanprogress.or
ajentleson@americanprogress.org
ajentleson@americanprogressaction.org
aju2@law.georgetown.edu
akarsner@manifestenergy.com
ake.sullivan@gmail.com
ake@gmail.com
akeslinke@albrightstonebridge.com
akimbrell@centerforfoodsafety.org
akshay@witnesslive.in
al1u0mat1cl_dwjfodo4s1h_c4dkjdymjwau-vtsf7rw@mail.gmail.com
alakiset@gmail.com
albright@georgetown.edu
alecexposed@googlegroups.com
alexander.laura@gmail.com
alexandra.phelan@gmail.com
alexis@organicconsumers.org
alexkoff@aol.com
ali@chelseaoffice.com
alice.e.cosgrove@gmail.com
alisagravitz@greenamerica.org
allak1979@gmail.com
allfacultyandstaff@law.georgetown.edu
allison@readyforhillary.com
allison@sptimes.com
allon@hillaryclinton.com
allone@drbronner.com
alloran@consumer.org
allstudents@law.georgetown.edu
almieri@gmail.com
almieri@hillaryclinton.com
almoro@hrcoffice.com
alter@gmail.com
am-argomny8v_tja81orekumquw5y_u0oovnnfkptdyq@mail.gmail.com
am6skpusscae3xwnkp++_gfkf61w1zin6evtohialfxw@mail.gmail.com
am@hillaryclinton.com
amanatos@manatos.com
amanda.shanor@gmail.com
amandarenteria@gmail.com
amarvel@americanprogress.org
ambity@aol.com
ammie@progressiveaccountability.org
amoreno@progressivemediausa.org
amorris@brookings.edu
ams@hillaryclinton.com
amy@fundforamerica.net
an@consumer.org
an@gmail.com
an@hillaryclinton.com
ana.unruhcohen@mail.house.gov
anai@gqrr.com
anas@hillaryclinton.com
and5@aol.com
andrea_t_taverna@cea.eop.gov
andres@progressiveaccountability.or
andres@progressiveaccountability.org
andrew_imparato@help.senate.gov
aneier@sorosny.org
angel@presidentclinton.co
angel@presidentclinton.com
aniel.jester@gmmb.com
aniello@progressnow.org
anielloa@gmail.com
anistan-network@googlegroups.com
anita_breckenridge@who.eop.gov
anna.burger@seiu.org
annaoffit@gmail.com
anne.hall@aporter.com
ansen@consumer.org
anson.kaye@gmmb.com
antholis@virginia.edu
antonia.blumberg@huffingtonpost.com
aoa15p3s0puknvuvrsmgfskewsw@mail.gmail.com
apence@cov.com
apgjxu9l_tx+qdcpjhzzn4rd4dhs0ne2csg7dqmfvy0g@mail.gmail.com
aphilipps@hillaryclinton.com
aphillips@hillaryclinton.com
aprice@americanprogressaction.org
apunmgwc5vvxq@mail.gmail.com
aq@mail.gmail.com
aqzvvmprxgjxb1idbfafufffulymphvcblxbf1d0wquss1fqdbyburfcr1sfafcuagofcgif@bounce.bluestatedigital.com
aqzvvmpsvgvduvjxuarsbwamvvagphvcblxbf1d0wquss1fqdbyburfcr1sfafcuagogagup@bounce.bluestatedigital.com
aqzvvmpuvadrcwqmaqedvfipcaocphvcblxbf1d0wquss1fqdbyburfcr1sfafcuagoaaacd@bounce.bluestatedigital.com
aqzvvmpvvancbwehb1mgwvtcvlmmphvcblxbf1d0wquss1fqdbyburfcr1sfafcuagobaamo@bounce.bluestatedigital.com
aqzvvmpwuwbdcwynbvicu1vaaqnwphvcblxbf1d0wquss1fqdbyburfcr1sfafcuag0cbwap@bounce.bluestatedigital.com
aqzvvmpwuwzqa1iaafcfbvabagpsphvcblxbf1d0wquss1fqdbyburfcr1sfafcuag0cbwyc@bounce.bluestatedigital.com
aqzvvmpwvarucwafuaeeugjabvydphvcblxbf1d0wquss1fqdbyburfcr1sfafcuag0caaqg@bounce.bluestatedigital.com
aqzvvmpwvwfdbvrxb1qhbvvbuqoephvcblxbf1d0wquss1fqdbyburfcr1sfafcuag0cawep@bounce.bluestatedigital.com
ara@progressiveaccountability.org
aren.l.dunn@gmail.com
arenteria@hillaryclinton.com
argolis@gmmb.com
arjans@naturespath.com
ark@genatural.com
arshall@hillaryclinton.com
as3591@law.georgetown.edu
asaharia@wc.com
aspeight@nea.org
astephens@naturespath.com
at@cov.com
atfedplayers@ourpublicservice.org
atham@hillaryclinton.com
atothi@t-online.hu
aubrey.allegretti@huffingtonpost.com
auditor@co.muscatine.ia.us
auditr58@louisacomm.net
aul@hillaryclinton.com
aurena@clintonfoundation.org
aurena@hillaryclinton.com
automailer-cbbounce@mailer4.alumniconnections.com
autumn.brewington@washpost.com
avid@db-research.com
avzcugg4hda+eawfoj5hkxlynj1v0cyrygvko+gczbeg@mail.gmail.com
awilder@usip.org
ay@hillaryclinton.com
b075174e-a48b-4c7d-9dee-10936076ef01@aol.com
b0758428-5fef-4611-a374-aa1d1da1aa2b@podesta.com
b0a2e18c-798c-4af5-a068-2b5e201607d7@gmail.com
b0cac8fe90557deb5b5eb4623b633019@mail.gmail.com
b16ba73e6856aba8f6b318dad2fcc4f5@mail.gmail.com
b1eeb3a90807021106x18f0ae7dha2bb1dc266e54377@mail.gmail.com
b1eeb3a90807180759h790dfacfy92e7174c9e198d59@mail.gmail.com
b21a82f4955947969770abc5d2f5df11@kslawmail.com
b22505342ce393448344de4a06565796011eb0d6@naimail6.networkalliance.net
b23e3a9e4f1ae0d77089cd6e7b936c6d@bounce.bluestatedigital.com
b2u4x4abpuxz
-g-irtux2d-mqs4st9@mail.gmail.com
b3c151a15cfbb0448ab2405172ff6b69@namprd03.prod.outlook.com
b46f42d8-4388-4833-a901-a685e6531ac7@gmail.com
b4a16542dc694add85c831827b5b63ee@johndouglassforcongress.com
b602ac7f727ed21aeb4429165aee99b8@bounce.bluestatedigital.com
b67a1300a8d26c49ada68a078cbb47a9263eb2bb08@cbivexmb04dc.cov.com
b7f2fb696c47045913ec93d4f26bc476@bounce.bluestatedigital.com
b7fae699-47ec-4d64-91b2-7f35ae3e65d9@aol.com
b7pz30bsfjza34cq@mail.gmail.com
b8a53e32f07b088982d0a066d33336d1@bounce.bluestatedigital.com
b8e0375673c6bce1ff23135f2cd464db@mail.gmail.com
b9c1ac19-80fb-4d61-826d-abdfa15c9f6e@gmail.com
b9eb2d8a16c7bc4bab776c8e74f8778d@namprd03.prod.outlook.com
b9f1f775562245ad91a0be1ed29c659a@co2pr06mb633.namprd06.prod.outlook.com
ba129304-2bed-470f-a2ff-c2060ef42992@americanbridge.org
ba8d71d8367541c4b358234b0f8975d6@co1pr07mb313.namprd07.prod.outlook.com
ba@mail.gmail.com
backtalk@motherjones.com
balcantara@hillaryclinton.com
bari@chelseaoffice.com
barilurie@gmail.com
bas131@aol.com
bay129-w295a02457b5904ed63f20ebe6d0@phx.gbl
bay129-w31308ed2b12f466f609b8bbe720@phx.gbl
bay174-w40ce6b3780c8bf16ea5f1bd8000@phx.gbl
bay174-w452b28dc979e98b6820c0ad8060@phx.gbl
bay174-w4993d7d242e0def1b4e829d8060@phx.gbl
bayy_kfbtsh1rssnufnh6keyxkh2aoegr_igz0uk0kna@mail.gmail.com
bazcvw8ra1gmrvu8blybbwiibayculjvwwggut9ewgwls0zabwevqarzv1hqdf9pafzdowuduaq@bounce.bluestatedigital.com
bb943.611cc343.427f5b04@aol.com
bbb_v+c2tuoy_zj4wt64h-ge3x9khpb77ob4zea@mail.gmail.com
bbc7e7c0807081942j6b663a5bjdd16515661cae68c@mail.gmail.com
bbc7e7c0807151940t52c153e8x9a8b53e1acf1eb0f@mail.gmail.com
bbc7e7c0807151943i51055935v469d5cdd358cb6f4@mail.gmail.com
bbc7e7c0807171954t78f983f0q191415589cb607c7@mail.gmail.com
bbc7e7c0807290819w676a5367w95f9ede744bae9c1@mail.gmail.com
bbc7e7c0807310925n720f48edn7f44c603fdf8cb6d@mail.gmail.com
bbc7e7c0808031307r40b37c41keb24aba56a83b229@mail.gmail.com
bbc7e7c0808031309x61e605b3lccac518c4cde5da4@mail.gmail.com
bbc7e7c0808041930m6dc3b4bdl284e7d42911d8b8a@mail.gmail.com
bbc7e7c0808041933o37566f69w336abbb3b258de28@mail.gmail.com
bbc7e7c0808061916t7bbac17dp2ba46643cf848d84@mail.gmail.com
bbc7e7c0809150714m1a8eaa5fw85b769d0c89cecf1@mail.gmail.com
bbc7e7c0810022102v56d05fc6idf384c66da91baab@mail.gmail.com
bbc7e7c0810022104h5a99fbcgb3254d3fcf5a34ed@mail.gmail.com
bbd6df6b431c6a30f889ca5dfe36346d@mail.gmail.com
bblechman@stimson.org
bbnanna11@gmail.com
bbu534ffpcnrkerrjspoed9dw6nc9f_inogpso_sa@mail.gmail.com
bbymook2015@gmail.com
bc9f56a1-18e4-44c7-861f-094e207f7959@gmail.com
bcaa6_d3exp1mu8eb+x2fqcsabva@mail.gmail.com
bcb1ef79431aface7fc6ab645234123d@mail.gmail.com
bcb88f01-ae78-4744-9af2-2b33c520c7dd@aol.com
bccbf733-f56b-4db3-8cab-e0f573318a4b@gmail.com
bchang@albrightstonebridge.co
bchang@albrightstonebridge.com
bcontractor@hillaryclinton.com
bcraig@hillaryclinton.com
bdarling@cdrnys.org
be07138a44cf7a4ba7e4784f083c7a35@namprd03.prod.outlook.com
be7uxgriy3w@mail.gmail.com
be858a46280a4fecbaef0e7487bfae4d@co1pr07mb313.namprd07.prod.outlook.com
be9a62a981f1b4f177bbc02a53dae00c@ofa0.bounce.bluestatedigital.com
be9db2d4bc6ecf478ec3dbda0e5710c7@exchange.mit.edu
be@googlegroups.com
bea8f0b1-ce13-4fc1-882d-ef0bdcedba4d@xtgap4s7mta1365.xt.local
beb6f220a27340db946aef3ca88bfa8d@garamendi.org
becker.josh@gmail.com
belfer_center@hks.harva
belfer_center@hks.harvard.edu
benenson@bsgco.com
benkobren@gmail.com
berger@hillaryclinton.com
bf708845-282e-4fd6-b30f-c7ae05a8671b@xtgap4s7mta4360.xt.local
bfa637c3-02b8-42e6-b48d-9987d57da19d@gmail.com
bfallon@hillaryclinton.co
bfallon@hillaryclinton.com
bfisher@gqrr.com
bfjxvwicagzdaljtavvqvfiw@bounce.bluestatedigital.com
bhouse5@bloomberg.net
bhupinder@witnesslive.in
bigcampaign+bncbcc67d66uaprbbfprkiakgqemsmhg7i@googlegroups.com
bigcampaign+bncbcd4bi6f3ipbb5vkzwbakgqethjm5bq@googlegroups.com
bigcampaign+bncbcd4bi6f3ipbbbmrukiqkgqe4buiroy@googlegroups.com
bigcampaign+bncbcd4bi6f3ipbbenlxkdakgqeq26yvwa@googlegroups.com
bigcampaign+bncbcd4bi6f3ipbbipyr6iqkgqehjsskaq@googlegroups.com
bigcampaign+bncbcd4bi6f3ipbbyweygiqkgqer42d6ti@googlegroups.com
bigcampaign+bncbdiixznq5ycrbugj42bakgqer5abibi@googlegroups.com
bigcampaign+bncciev1o2kcxc8w-zebboe2ywkdg@googlegroups.com
bigcampaign+bncciev1o2kcxdquerfbboew3enyg@googlegroups.com
bigcampaign+bnccifao8xahhc4spnjbboedtojpg@googlegroups.com
bigcampaign+bnccifao8xahhc5kv_qbboezddw5w@googlegroups.com
bigcampaign+bnccifao8xahhc_0nbwbboeubljjg@googlegroups.com
bigcampaign+bnccifao8xahhcbkjllbboej0aodq@googlegroups.com
bigcampaign+bnccifao8xahhcp-d7obboenmla0a@googlegroups.com
bigcampaign+bnccifao8xahhcv8rvpbboefocdea@googlegroups.com
bigcampaign+bnccifao8xahhddrq_ubboeym-xuw@googlegroups.com
bigcampaign+bnccifao8xahhdr-qzsbboesni9_w@googlegroups.com
bigcampaign+bnccifao8xahhdyzn-abroel5ptoa@googlegroups.com
bigcampaign+bnccjgvyerqfxc3iehrbboeltl1mw@googlegroups.com
bigcampaign+bnccjh9n4qtaxdz4znkbboezrz19w@googlegroups.com
bigcampaign+bnccjhwhlkfdhdax6scbroewqi2wq@googlegroups.com
bigcampaign+bncclubnaiadxdp-nflbboeljxl5g@googlegroups.com
bigcampaign+bnccmns9manahd10k7lbboetn3wga@googlegroups.com
bigcampaign+bnccncl5bdubrc52dflbboedbgdda@googlegroups.com
bigcampaign+bnccnof9-ycfrddz_-bbroepamlwa@googlegroups.com
bigcampaign+bnccpctl8_mbrdy_6jhbboelzqmzg@googlegroups.com
bigcampaign+bnccpyyu4rndrc28lplbboe0zwvrg@googlegroups.com
bigcampaign+bnccpyyu4rndrciobllbboepyguka@googlegroups.com
bigcampaign+bnccpyyu4rndrcw7kzlbboej28dna@googlegroups.com
bigcampaign+bnccpyyu4rndrdnip6bbroeqtp10a@googlegroups.com
bigcampaign+bnccpyyu4rndrdvtvflbboeuabwmq@googlegroups.com
bigcampaign+help@googlegroups.com
bigcampaign+owner@googlegroups.com
bigcampaign+owners@googlegroups.com
bigcampaign+subscribe@googlegroups.com
bigcampaign+unsubscribe@googlegroups.com
bigcampaign-help@googlegroups.com
bigcampaign-owner@googlegroups.com
bigcampaign-unsubscribe@googlegroups.com
bigcampaign@googlegroups.com
bij5pieeauz0sxqdg@mail.gmail.com
bill.danvers@gmail.co
bill.danvers@gmail.com
bill@sinocism.com
bipoole@verizon.net
bjkiley@aol.com
bk7ng@mail.gmail.com
bkatulis@americanprogress.org
bkotschwar@georgetown.edu
bl2pr03mb114117363f5eb1ea4461330c30e0@bl2pr03mb114.namprd03.prod.outlook.com
bl2pr03mb114e7c73148f36e37c37af0ddd50@bl2pr03mb114.namprd03.prod.outlook.com
blackwoodward@gmail.com
bleeker@bpimedia.com
blevin@stifel.com
blindsey@clintonfoundation.org
blog-cabal@googlegroups.com
blu178-w208abf201a2d238b30716da5280@phx.gbl
blu178-w26c8983405d32ef4c1630ea53c0@phx.gbl
blu178-w305bec1e421d4ecfc5b5a1a5110@phx.gbl
blu178-w6ec9fa129c321378bca1aa5320@phx.gbl
blu436-smtp1612c7abb5d7b243f94a78cdfe00@phx.gbl
blupr03mb1329b618ef99929b5f8bfe90c3f20@blupr03mb1329.namprd03.prod.outlook.com
blupr03mb2134d8bb42f1b1638895e4fc3f20@blupr03mb213.namprd03.prod.outlook.com
blupr03mb214fe54d466d78ef278b062b7f30@blupr03mb214.namprd03.prod.outlook.com
blupr05mb02380c705c23e76e95e89debaa10@blupr05mb023.namprd05.prod.outlook.com
blupr05mb193931c2f51f1985c3f0a413bc280@blupr05mb1939.namprd05.prod.outlook.com
blupr05mb291e7b8701e527d386956cada130@blupr05mb291.namprd05.prod.outlook.com
blupr05mb2921d8648bb0d9bf37c6297da130@blupr05mb292.namprd05.prod.outlook.com
blupr05mb4980d1b13d447e819806305ab230@blupr05mb498.namprd05.prod.outlook.com
blupr0701mb0995669850ce67b4b34a867093a20@blupr0701mb0995.namprd07.prod.outlook.com
blupr0701mb1748636db27eb3728a766ada93b20@blupr0701mb1748.namprd07.prod.outlook.com
blupr0701mb178009ab639df4d0f42211be93b40@blupr0701mb1780.namprd07.prod.outlook.com
blupr0701mb20022e25d5c78445f743343593460@blupr0701mb2002.namprd07.prod.outlook.com
blupr0701mb803ac67ad3fad281b11a8faa33c0@blupr0701mb803.namprd07.prod.outlook.com
blupr0701mb803d31bf0ef30592fff5c2ba33b0@blupr0701mb803.namprd07.prod.outlook.com
blupr0701mb804cc322123af31fe49cf9ea33b0@blupr0701mb804.namprd07.prod.outlook.com
blupr07mb09737f0cb4669faec84d35d93f50@blupr07mb097.namprd07.prod.outlook.com
blupr07mb0974b160e590dcae459324293050@blupr07mb097.namprd07.prod.outlook.com
blupr07mb0983c47487e1b1c8890a918934d0@blupr07mb098.namprd07.prod.outlook.com
blupr07mb0987223e791f0a33af732df93d20@blupr07mb098.namprd07.prod.outlook.com
blupr07mb0993029e3300bfba7627ddc930d0@blupr07mb099.namprd07.prod.outlook.com
blupr07mb0993397a26f58be995dc74293f70@blupr07mb099.namprd07.prod.outlook.com
blupr07mb09943efc21061bc3662db4693370@blupr07mb099.namprd07.prod.outlook.com
blupr07mb0997f805a3a710875eec427932c0@blupr07mb099.namprd07.prod.outlook.com
blupr07mb099b943a63dd3eebe9c27b2934e0@blupr07mb099.namprd07.prod.outlook.com
blupr07mb099f946b16b1fb7542f885b931b0@blupr07mb099.namprd07.prod.outlook.com
blupr07mb1003eb020fb12671041450993d80@blupr07mb100.namprd07.prod.outlook.com
blupr07mb10042430e6ce6ff9fc92e5893da0@blupr07mb100.namprd07.prod.outlook.com
blupr07mb10047b9e629ed72a8cede7993e80@blupr07mb100.namprd07.prod.outlook.com
blupr07mb10098e4726f070858d5b0cf93380@blupr07mb100.namprd07.prod.outlook.com
blupr07mb100c174026eb80dbc5988d7b8390@blupr07mb100.namprd07.prod.outlook.com
blupr07mb100e4bf3675af2d819476bf93270@blupr07mb100.namprd07.prod.outlook.com
blupr07mb32222d7659a3fb26e6e1ba1d9c10@blupr07mb322.namprd07.prod.outlook.com
blupr07mb3222356a89eea6dae54564dd9680@blupr07mb322.namprd07.prod.outlook.com
blupr07mb3228113d9600ab0ec2083ced9780@blupr07mb322.namprd07.prod.outlook.com
blupr07mb322ab9a17a9f1be9d99b19dd9670@blupr07mb322.namprd07.prod.outlook.com
blupr07mb322fd874a548b36f75641f2d9780@blupr07mb322.namprd07.prod.outlook.com
blupr07mb32421e90994dbbeba924c99d9c10@blupr07mb324.namprd07.prod.outlook.com
blupr07mb324db9c36d4de3e0d481c04d9670@blupr07mb324.namprd07.prod.outlook.com
blupr07mb52928eb2a4ea155233d400d931d0@blupr07mb529.namprd07.prod.outlook.com
blupr07mb5293dd8357498d68cee41e593f40@blupr07mb529.namprd07.prod.outlook.com
blupr07mb5295aab2c33a6079ed842cd930e0@blupr07mb529.namprd07.prod.outlook.com
blupr07mb529a92d3cd0aab2d1610b82931e0@blupr07mb529.namprd07.prod.outlook.com
blupr07mb5302273462fd04a76b575c393e90@blupr07mb530.namprd07.prod.outlook.com
blupr07mb530a998999c7add4532b3fd930e0@blupr07mb530.namprd07.prod.outlook.com
blupr07mb530b032e89c98b76ea1fd4993df0@blupr07mb530.namprd07.prod.outlook.com
blupr07mb530e88703573973aa25c7bc93110@blupr07mb530.namprd07.prod.outlook.com
blupr07mb5310cf3348f23ecc91f655893480@blupr07mb531.namprd07.prod.outlook.com
blupr07mb5318f1b3f549fee45976d2b93f20@blupr07mb531.namprd07.prod.outlook.com
blupr07mb531b2afd0617a488babe4ba93c10@blupr07mb531.namprd07.prod.outlook.com
blupr07mb531df4c408aa89f3f5e891393290@blupr07mb531.namprd07.prod.outlook.com
blupr07mb5322897b2d128980953869193180@blupr07mb532.namprd07.prod.outlook.com
blupr07mb532ee3c3bd80624e95c318393230@blupr07mb532.namprd07.prod.outlook.com
blupr07mb545423f4082bd838c643ca6932a0@blupr07mb545.namprd07.prod.outlook.com
blupr07mb5457b08ebd357bf6ccfa96c93e70@blupr07mb545.namprd07.prod.outlook.com
blupr07mb545d3489dac2bb62af99b6193e20@blupr07mb545.namprd07.prod.outlook.com
blupr07mb546069dbf7cfef5be5cc1a193310@blupr07mb546.namprd07.prod.outlook.com
blupr07mb546ec41e6341fea15ee3f0493db0@blupr07mb546.namprd07.prod.outlook.com
blupr07mb5478b8d4bfedf8b2bffc95a934b0@blupr07mb547.namprd07.prod.outlook.com
blupr07mb5478f9589f1a6181e1643a193cd0@blupr07mb547.namprd07.prod.outlook.com
blupr07mb548375d444f062634f74c2a93aa0@blupr07mb548.namprd07.prod.outlook.com
blupr07mb548c523ecfe8258d6bca93d93fa0@blupr07mb548.namprd07.prod.outlook.com
blupr07mb627a53509c8bd0a0053f9ec93be0@blupr07mb627.namprd07.prod.outlook.com
blupr07mb865ae0e583b83ced6ce9609b5cb0@blupr07mb865.namprd07.prod.outlook.com
blupr07mb866174f1855ad469f880bbbb5cb0@blupr07mb866.namprd07.prod.outlook.com
blupr0801mb625336149e0d5fa3361bf64dde00@blupr0801mb625.namprd08.prod.outlook.com
blupr0801mb62543135224765420eb2c6edde00@blupr0801mb625.namprd08.prod.outlook.com
blupr0801mb625b86c877b73b81d8f5806dafc0@blupr0801mb625.namprd08.prod.outlook.com
blupr0801mb625e3057a4c738b433f44baddfc0@blupr0801mb625.namprd08.prod.outlook.com
blurie@clintonfoundation.org
bn1pr0301mb072191b86dda716aab23ce88c3040@bn1pr0301mb0721.namprd03.prod.outlook.com
bn1pr05mb0288824d8815824534634b2c2a00@bn1pr05mb028.namprd05.prod.outlook.com
bn1pr05mb09187067f7e8e6b802adc65d6fd0@bn1pr05mb091.namprd05.prod.outlook.com
bn1pr05mb153fcd546ed7dee3746f6efd6fd0@bn1pr05mb153.namprd05.prod.outlook.com
bn1pr07mb02174fdba46e6816806125693590@bn1pr07mb021.namprd07.prod.outlook.com
bn1pr07mb10149952025faeecde5dad893ca0@bn1pr07mb101.namprd07.prod.outlook.com
bn1pr07mb10189a3d3eb7febd28a687893430@bn1pr07mb101.namprd07.prod.outlook.com
bn1pr07mb101aae95ea482c5d9caeb0893000@bn1pr07mb101.namprd07.prod.outlook.com
bn1pr07mb1029ca79bc220df72e47af393e80@bn1pr07mb102.namprd07.prod.outlook.com
bn1pr07mb102e9794886d9465289f02893d20@bn1pr07mb102.namprd07.prod.outlook.com
bn1pr07mb1030c5cde00bffdab9d850093ed0@bn1pr07mb103.namprd07.prod.outlook.com
bn1pr07mb1040ff554198c4615450c1f93e40@bn1pr07mb104.namprd07.prod.outlook.com
bn1pr07mb1045486beaf667add0d24dc93110@bn1pr07mb104.namprd07.prod.outlook.com
bn1pr07mb1047a875ed4074f7e0e61f493d80@bn1pr07mb104.namprd07.prod.outlook.com
bn1pr07mb104cede6c944c73e95ccdfc933f0@bn1pr07mb104.namprd07.prod.outlook.com
bn1pr07mb104f2d4f83065b5a23e402c93ef0@bn1pr07mb104.namprd07.prod.outlook.com
bn1pr07mb357ff4843eb315d19dc055a93be0@bn1pr07mb357.namprd07.prod.outlook.com
bn3pr01mb1318f859eec5ee5fa8adae7eeaa70@bn3pr01mb1318.prod.exchangelabs.com
bn3pr0701mb1105f5f566b7843b3e396fac93a50@bn3pr0701mb1105.namprd07.prod.outlook.com
bn3pr0701mb11084ad9121a3c1ef1c198fd93a40@bn3pr0701mb1108.namprd07.prod.outlook.com
bn3pr0701mb13933932e13c3f5dfab4e7a793b30@bn3pr0701mb1393.namprd07.prod.outlook.com
bn4pr07mb2276493ad88db8e77ce2d396938f0@bn4pr07mb2276.namprd07.prod.outlook.com
bnp7o7veq@mail.gmail.com
bob.adapt@sbcglobal.net
bob.harrison@clintonglobalinitiative.org
bobperciasepe@c2es.org
bois@progressivemediausa.org
bombardieri@globe.com
bonbonlh@yahoo.com
bounce-20_html-2481184-1106-7208679-4949@bounce.morning7.theskimm.com
bounce-20_html-2481184-1127-7208679-4949@bounce.morning7.theskimm.com
bounce-20_html-2481184-1182-7208679-4962@bounce.morning7.theskimm.com
bounce-20_html-2481184-1185-7208679-4961@bounce.morning7.theskimm.com
bounce-20_html-2481184-1298-7208679-4961@bounce.morning7.theskimm.com
bounce-20_html-2481184-1928-7208679-4106@bounce.morning7.theskimm.com
bounce-20_html-2481184-600-7208679-4952@bounce.morning7.theskimm.com
bounce-20_html-2481184-602-7208679-4952@bounce.morning7.theskimm.com
bounce-20_html-2481184-604-7208679-4952@bounce.morning7.theskimm.com
bounce-20_html-2481184-608-7208679-4952@bounce.morning7.theskimm.com
bounce-20_html-2481184-620-7208679-4951@bounce.morning7.theskimm.com
bounce-20_html-2481184-630-7208679-4954@bounce.morning7.theskimm.com
bounce-20_html-2481184-721-7208679-4953@bounce.morning7.theskimm.com
bounce-20_html-2481184-746-7208679-4953@bounce.morning7.theskimm.com
bounce-20_html-2481184-923-7208679-4951@bounce.morning7.theskimm.com
bounce-bqpljcqlqfdyfbcbqfykpntjkkcpjkjjpftsqqzqqjztbbfnmpc@townhallmail.com
bounce-cdmdgjldlphfghdtcpfrtsngrrjtgrggtpnkllmllgmnqqpsztj@townhallmail.com
bounce-msbqtbdqdywlypyspclgcjktggbctgttcykzddpddtpkssyjvcb@townhallmail.com
bounce-nkjytrpypfwntwwkprnhqbzthhrqthttqfzcppkpptkzjjfbmqr@townhallmail.com
bounce-ntpytrpypfwnfkypyynhqbzthhrqthttqfzcppkpptkzjjfbmqr@townhallmail.com
bounce-qdgwvpfwfsntsfpgwwtqmcbvqqpmvqvvmsbjffdffvdbhhscrmp@townhallmail.com
bounce-qnpwvpfwfsntsfhvpptqmcbvqqpmvqvvmsbjffdffvdbhhscrmp@townhallmail.com
bounce-rwcrktvrvnjpkjkgvvpfcsqkfftckfkkcnqhvvlvvklqwwnsbct@townhallmail.com
bounce-wzwlwnslsvfbvzssnlbqdhywqqndwqwwdvytssjsswjyzzvhmdn@townhallmail.com
bounce@bounce.myngp.com
bounce@ms3.lga2.nytimes.com
bounce_1236711-2514-120550507-7257726_t@bounce.myngp.com
bounce_1237478-2514-120608799-7257726_t@bounce.myngp.com
bounce_2100000256130112_pod12@bounce.myngp.com
bounce_2400000074542058_pod2@bounce.myngp.com
bounce_2400000096819043_pod2@bounce.myngp.com
bounce_2400000100798119_pod2@bounce.myngp.com
bounce_2400000145191088_pod12@bounce.myngp.com
bounce_2400000167504915_pod12@bounce.myngp.com
bounce_775434-3841-56716954-8958371_t@bounce.myngp.com
bounce_780546-3841-57133146-8958371_t@bounce.myngp.com
bounce_796837-3841-58671299-8958371_t@bounce.myngp.com
bouncebacks@gmfus.org
bouncebacks@kslaw.com
bounces-f3b12fa708-08a29c1973@b.cts.vresp.com
brackenhendricks@gmail.com
breakingnews@politico.com
brentbbi@webtv.net
brethayworth@siouxcityjournal.com
brewingtona@washpost.com
brian_c_deese@who.eop.gov
brianefallon@gmail.com
briedel@brookings.edu
brittany@chelseaoffice.com
broadcast@law.georgetown.edu
brody@hillaryclinton.com
brubin@hillaryclinton.com
bsamantha@gmail.com
bsqfdegdbhu3f22ysc7jfnm-bcg@mail.gmail.com
bstrider@americanbridge.org
bsurk@politico.eu
btumulty@gns.gannett.com
bulletin@hillaryclinton.com
burke1262@cox.net
burkese@comcast.net
burns.strider@americanbridge.org
buzzbybrown@gmail.co
buzzbybrown@gmail.com
bva3zxs41qr9vnvb8za1tcyprgof4e9d3za1t-uqidqa@mail.gmail.com
bweiland@pmidpi.com
bwineke@madison.com
bwoodward@mkalbright.com
bxbfxa0bfucdrfq8b1wcu1ipbamevfmeva9rbj9-wgwls2zabwevqarzv1hqdf9pafzdowwbxa@bounce.bluestatedigital.com
bxbfxa0bfucdrfq8b1wfuaddvqaddlmfwlxtat9-wgwls2zabwevqarzv1hqdf9pafzdowwpvq@bounce.bluestatedigital.com
by1pr0501mb152506f26783003722279ddeb5e90@by1pr0501mb1525.namprd05.prod.outlook.com
by1pr0501mb1525f61cffad6264381501fcb57a0@by1pr0501mb1525.namprd05.prod.outlook.com
by1pr0501mb15264220e78ad57dd097ef42b58d0@by1pr0501mb1526.namprd05.prod.outlook.com
by1pr0501mb15269769bed2ac02c0c36703b57a0@by1pr0501mb1526.namprd05.prod.outlook.com
by1pr0501mb15275dabe15177bed9e7207ab5770@by1pr0501mb1527.namprd05.prod.outlook.com
by1pr0501mb1527bb29a041de19af101e18b53c0@by1pr0501mb1527.namprd05.prod.outlook.com
by1pr0501mb1527d6d17d6b67337d676669b57a0@by1pr0501mb1527.namprd05.prod.outlook.com
by1pr0501mb1528f62614ea002c428a47acb5b90@by1pr0501mb1528.namprd05.prod.outlook.com
by1pr0701mb1658996ae7d50837b3e4182dbe340@by1pr0701mb1658.namprd07.prod.outlook.com
by1pr0701mb1768f02f87d90acf220c30c7b2e70@by1pr0701mb1768.namprd07.prod.outlook.com
by1pr0801mb09818011c6a4f2fb9de683a5ba1e0@by1pr0801mb0981.namprd08.prod.outlook.com
by1pr0801mb098212b474963344bbde98b78e1e0@by1pr0801mb0982.namprd08.prod.outlook.com
by1pr12mb0470ae793ed7ecff5ce188e2dcc60@by1pr12mb0470.namprd12.prod.outlook.com
by1pr12mb0471a697abd06b8b075c3b78dcc50@by1pr12mb0471.namprd12.prod.outlook.com
by2pr0301mb0613925950d2962f57b464739b130@by2pr0301mb0613.namprd03.prod.outlook.com
by2pr0301mb061490320ee46f7aa17c4fac9b280@by2pr0301mb0614.namprd03.prod.outlook.com
by2pr0301mb0614d39755fa151b74ab8f959b120@by2pr0301mb0614.namprd03.prod.outlook.com
by2pr0301mb06164508dd28b0fb17db19058e110@by2pr0301mb0616.namprd03.prod.outlook.com
by2pr0301mb06165153fda9209c66871b2b9b100@by2pr0301mb0616.namprd03.prod.outlook.com
by2pr0301mb061652d7307357b1d08e76a8cc2a0@by2pr0301mb0616.namprd03.prod.outlook.com
by2pr0301mb0725261d49207b9ddc2b96ffc3260@by2pr0301mb0725.namprd03.prod.outlook.com
by2pr0301mb0725a8a7481ef33979ea96a7c3ff0@by2pr0301mb0725.namprd03.prod.outlook.com
by2pr0301mb0725ab693b50637729a8d1c6fc160@by2pr0301mb0725.namprd03.prod.outlook.com
by2pr0301mb0725b29993188f4c997513f9c30b0@by2pr0301mb0725.namprd03.prod.outlook.com
by2pr0301mb0725b73f31cf4d35809caf41c3050@by2pr0301mb0725.namprd03.prod.outlook.com
by2pr0301mb0725bc5c758781a705c86184c33a0@by2pr0301mb0725.namprd03.prod.outlook.com
by2pr0301mb0725caa567dc426982cb71d2c3270@by2pr0301mb0725.namprd03.prod.outlook.com
by2pr0301mb0725d73d4550641829ea5aa8c30a0@by2pr0301mb0725.namprd03.prod.outlook.com
by2pr0301mb0725e14e56c783aa670b299fc3390@by2pr0301mb0725.namprd03.prod.outlook.com
by2pr0301mb0726152c482ba31a6493ec13c30c0@by2pr0301mb0726.namprd03.prod.outlook.com
by2pr0301mb072735125545b008157d977ec30c0@by2pr0301mb0727.namprd03.prod.outlook.com
by2pr0301mb0727404c66d19d4af5e47964fc170@by2pr0301mb0727.namprd03.prod.outlook.com
by2pr03mb126afc7f8e3de0b54692b04c30d0@by2pr03mb126.namprd03.prod.outlook.com
by2pr03mb2231f8db9594352fd11b7dac3f20@by2pr03mb223.namprd03.prod.outlook.com
by2pr0501mb1704138dd9700bf956a9968cd4390@by2pr0501mb1704.namprd05.prod.outlook.com
by2pr0501mb17045057fb58f2b959b6f9b0d4390@by2pr0501mb1704.namprd05.prod.outlook.com
by2pr0501mb17045e054becaa39a963d3d7d4390@by2pr0501mb1704.namprd05.prod.outlook.com
by2pr0501mb17046acaeac072d9334be257b5390@by2pr0501mb1704.namprd05.prod.outlook.com
by2pr0501mb170478525b071593ac28084fd4390@by2pr0501mb1704.namprd05.prod.outlook.com
by2pr0501mb17047f9181994af35d4a47b6d4390@by2pr0501mb1704.namprd05.prod.outlook.com
by2pr0501mb1704845e578332d3350a1aafd4390@by2pr0501mb1704.namprd05.prod.outlook.com
by2pr0501mb1704b61d2838cfd53c051bead4390@by2pr0501mb1704.namprd05.prod.outlook.com
by2pr0501mb1704b719f3dfb1d1ac527eccd4390@by2pr0501mb1704.namprd05.prod.outlook.com
by2pr0501mb1704b7b7ee501c4ad6cfe0aad4390@by2pr0501mb1704.namprd05.prod.outlook.com
by2pr0501mb1704f530ef40bb8c04d04c0dd4390@by2pr0501mb1704.namprd05.prod.outlook.com
by2pr05mb0292a9a50213fb7cfdd2478cfa00@by2pr05mb029.namprd05.prod.outlook.com
by2pr05mb031c6028b07b4f70fc00d65cfa00@by2pr05mb031.namprd05.prod.outlook.com
by2pr05mb19261000a76624248e2950aecfa00@by2pr05mb1926.namprd05.prod.outlook.com
by2pr05mb192639f9f3b4fb5332923a0ccfa10@by2pr05mb1926.namprd05.prod.outlook.com
by2pr05mb192696916f43e65d2d033529cfa00@by2pr05mb1926.namprd05.prod.outlook.com
by2pr05mb1926f9e33c29895aaad86230cfa10@by2pr05mb1926.namprd05.prod.outlook.com
by2pr05mb7741e5cff13b21622199492b5e90@by2pr05mb774.namprd05.prod.outlook.com
by2pr05mb776a7fa7272cda94074d992d4e90@by2pr05mb776.namprd05.prod.outlook.com
by2pr05mb78901f91c91a929f219cfb1cf150@by2pr05mb789.namprd05.prod.outlook.com
by2pr05mb789c904e8b4329cf232d238cf150@by2pr05mb789.namprd05.prod.outlook.com
by2pr05mb790f2dfc20fb72ec70e97c1cff50@by2pr05mb790.namprd05.prod.outlook.com
by2pr0701mb1958492e3a9f91f6d4f149f293b80@by2pr0701mb1958.namprd07.prod.outlook.com
by2pr0701mb2005da605dffc6a7cbd38dc493a50@by2pr0701mb2005.namprd07.prod.outlook.com
by2pr07mb105a255a44454ff4aa2824293c30@by2pr07mb105.namprd07.prod.outlook.com
by2pr07mb105a8f259e0010f36d1f819934c0@by2pr07mb105.namprd07.prod.outlook.com
by2pr07mb105dc5230cbb415bf47e69293d30@by2pr07mb105.namprd07.prod.outlook.com
by2pr07mb10656d8ebf450adf33b58ec934b0@by2pr07mb106.namprd07.prod.outlook.com
by2pr07mb1069c481d2334f5e7bec64793260@by2pr07mb106.namprd07.prod.outlook.com
by2pr07mb1073af7678965004ce29acb93c30@by2pr07mb107.namprd07.prod.outlook.com
by2pr07mb10755cddbe83ab912c15d2393440@by2pr07mb107.namprd07.prod.outlook.com
by2pr07mb1075d51ec7e2cc453dda50e93e60@by2pr07mb107.namprd07.prod.outlook.com
by2pr07mb10779de97d0cc93090e019193150@by2pr07mb107.namprd07.prod.outlook.com
by2pr07mb1078a660353f22815805d1d93340@by2pr07mb107.namprd07.prod.outlook.com
by2pr07mb107bd405630ffe8c190138993e10@by2pr07mb107.namprd07.prod.outlook.com
by2pr07mb1081fc9769d8293f19d379d93c20@by2pr07mb108.namprd07.prod.outlook.com
by2pr07mb48605d74ca20cbc1c13fbb193590@by2pr07mb486.namprd07.prod.outlook.com
by2pr07mb4882f1cc116b25e1c9b8e5a93a20@by2pr07mb488.namprd07.prod.outlook.com
by2pr07mb53390791173c2012a59e28393030@by2pr07mb533.namprd07.prod.outlook.com
by2pr07mb534cf2b8b4053dde093e12493170@by2pr07mb534.namprd07.prod.outlook.com
by2pr07mb534f12090eb9fe95f936f70933e0@by2pr07mb534.namprd07.prod.outlook.com
by2pr07mb53524fce207c65e4e72efc893c40@by2pr07mb535.namprd07.prod.outlook.com
by2pr07mb53642da041354e60865b94493e50@by2pr07mb536.namprd07.prod.outlook.com
by2pr07mb55004981e7327b6eb1e8ed993420@by2pr07mb550.namprd07.prod.outlook.com
by2pr07mb550e066623896f57bc5382d93c50@by2pr07mb550.namprd07.prod.outlook.com
by2pr07mb55106d596c6534b3e087a3e93440@by2pr07mb551.namprd07.prod.outlook.com
by2pr07mb5521496847d833e5fbcb31693430@by2pr07mb552.namprd07.prod.outlook.com
by2pr07mb552b822db7d791f1d2ad1f993da0@by2pr07mb552.namprd07.prod.outlook.com
by2pr08mb0305481b9f8e9c6e3bdfeeab3cc0@by2pr08mb030.namprd08.prod.outlook.com
by2pr08mb03097eae886a67c75592c4fb3df0@by2pr08mb030.namprd08.prod.outlook.com
by2pr08mb03133b92fd1fa91fc38b1eab3df0@by2pr08mb031.namprd08.prod.outlook.com
by2pr08mb0314f641f4340d76c624e04b3cc0@by2pr08mb031.namprd08.prod.outlook.com
by2pr16mb072861509920ee2159a6efeaa5da0@by2pr16mb0728.namprd16.prod.outlook.com
by2pr16mb0728f20b008812b4aaa7dcd7a5da0@by2pr16mb0728.namprd16.prod.outlook.com
by2pr16mb0728fdf6e96b6e74f788ffd9a5c20@by2pr16mb0728.namprd16.prod.outlook.com
bymook2015@gmail.com
byron@georgiouenterprises.com
byron@xgev.com
c03845e888ae7b42925564b311a8dcb19d3920c1@exmbx7.local.hrw.org
c094865c4b0ebc4cb20ddaf694e759387e6d417f@scg-lambx2.scg.corp
c094865c4b0ebc4cb20ddaf694e759387e8f7b68@scg-lambx2.scg.corp
c094865c4b0ebc4cb20ddaf694e759387e8f8729@scg-lambx2.scg.corp
c0j53vj_a@mail.gmail.com
c1yidloamw@mail.gmail.com
c2004079083f40f6b75c4a13b8eb8c6a@pogo.org
c20749e453b594428f78d4b9aa3de50903b49c5757@ctwexch.changetowin.org
c28de9b0807030536y674e4829tda474a32b8b8c5e3@mail.gmail.com
c28de9b0807080544w3c8a829cmd1c0c7074c65b486@mail.gmail.com
c28de9b0807090554i70035c94r8c768ecb9cead395@mail.gmail.com
c28de9b0807110540u68899374l75f2e99a4333c207@mail.gmail.com
c28de9b0807140510r62225d8o53f8ca75957a2f@mail.gmail.com
c28de9b0807150538ye020f40qeb45e9ffbdcd565@mail.gmail.com
c28de9b0807151056w4e8e6600i2229a3151e191e3@mail.gmail.com
c28de9b0807160534k358adb2ds98eb43b688b3f576@mail.gmail.com
c28de9b0807170530h2ce26605ne49cf1059c7fc587@mail.gmail.com
c28de9b0807171112l7835247ap2e3aa0cecc78beff@mail.gmail.com
c28de9b0807180545v2e4c1578ya352f148799066d3@mail.gmail.com
c28de9b0807180815o65dc1a45g894984184bdee3de@mail.gmail.com
c28de9b0807210544j667b3e61y2fab1674b60736c6@mail.gmail.com
c28de9b0807211203p5eb4db33sd3d28159124df39f@mail.gmail.com
c28de9b0807220528t3ba83b2ev18c28928aa7c6fc7@mail.gmail.com
c28de9b0807221054q4d94a100s5041ac41853f6ef5@mail.gmail.com
c28de9b0807230545i71c6295cg598438e1fa161655@mail.gmail.com
c28de9b0807230846o3edb2e76j58044bb824da71b7@mail.gmail.com
c28de9b0807240543q124a54d3x2586d46704ab07b@mail.gmail.com
c28de9b0807251258u67f9131m8c30802e3287464d@mail.gmail.com
c28de9b0807291154v14d9b43cxea16815f035387ea@mail.gmail.com
c28de9b0807300535k25178633o1589ac9edc9d6a8e@mail.gmail.com
c28de9b0807301133s1c74a526s5e8d4864f7a51b13@mail.gmail.com
c28de9b0807311139r6e976225w309625b265166783@mail.gmail.com
c28de9b0808010927k194255b1vb84aad7c3b3e890a@mail.gmail.com
c28de9b0808040538x17f03bc4l44cf448120c9dd02@mail.gmail.com
c28de9b0808050542s1d134bd2pa3d02051894d965b@mail.gmail.com
c28de9b0808051206v2ab4f0k1a3d007986fe2666@mail.gmail.com
c28de9b0808051735r231979c1i8f57edac31fbe931@mail.gmail.com
c28de9b0808060550r4172eb12g9c8c438f143a43f2@mail.gmail.com
c28de9b0808061056l31b2aba5rb8a3a1f63f50db77@mail.gmail.com
c28de9b0808070527p4ea354dpd9f9b0cb86a44aa5@mail.gmail.com
c28de9b0808071050q24caa859t5382a57fd1eeacc9@mail.gmail.com
c28de9b0808080939l373c5f71ic39fb7e37dddc532@mail.gmail.com
c28de9b0808081410j224e4d84i9af87c1cbcbc60f1@mail.gmail.com
c28de9b0808110551i6e5c9dfaj2ae1f3affd8f91d1@mail.gmail.com
c28de9b0808110816q22203052s8fcdfee61266cc82@mail.gmail.com
c28de9b0808110837g5ee5c7e0sc5467205855cf46a@mail.gmail.com
c28de9b0808111220i3a031d43he9d36cc9d018d52c@mail.gmail.com
c28de9b0808120539l47012323if3a0c082b23a7f5d@mail.gmail.com
c28de9b0808121104x17d8cc8duaf676d8905949701@mail.gmail.com
c28de9b0808121452u20bf733euc5e175f78b185a28@mail.gmail.com
c28de9b0808130544l475253d4p9d86e49443bb3971@mail.gmail.com
c28de9b0808131414p656e9b4fq880628cfa0b46e54@mail.gmail.com
c28de9b0808131636p66225636tfbb796ed3be136be@mail.gmail.com
c28de9b0808140549o4d6a1f92y36c8e9a8c264f10a@mail.gmail.com
c28de9b0808141633k4ac1ec4cl1908f366150264ed@mail.gmail.com
c28de9b0808150542n6fa72ef2lf46fd14595741528@mail.gmail.com
c28de9b0808151221i7ee2bd4br8e6e5bf26101a052@mail.gmail.com
c28de9b0808161938n728ba8dasc252e453e916c45@mail.gmail.com
c28de9b0808180536s16864e91yb11ca9b7587a74a7@mail.gmail.com
c28de9b0808180724kef21f5y9043da6dacb130e0@mail.gmail.com
c28de9b0808190543k65dc7f3dof3b048be976686d2@mail.gmail.com
c28de9b0808250535r7aaf0582i47b65b272a7c80b@mail.gmail.com
c28de9b0808260613l679db44dmdcee6641e45de78@mail.gmail.com
c28de9b0809020549p53a3d3e2va637488b290a4c31@mail.gmail.com
c28de9b0809040554i79b9fe1at627fadc2296a527c@mail.gmail.com
c28de9b0809081040y43b46765o98f4c870d2677a47@mail.gmail.com
c28de9b0809091358t16c44f8eha2e19e52da7c07e9@mail.gmail.com
c28de9b0809150531l564c1a0q95d6ac0453e2632@mail.gmail.com
c28de9b0809160552y799e17eax347341e250430035@mail.gmail.com
c28de9b0809170542k5ef6fc73ib10ab2d5a7a97140@mail.gmail.com
c28de9b0809190548h7cc0a1b0l5ca0d97b99ba7c0e@mail.gmail.com
c28de9b0809190657o78ad154v874c9e071eb54202@mail.gmail.com
c28de9b0809300941u3a22372dmcb9dde500b957bf2@mail.gmail.com
c28de9b0810010845ve4e88e7mb4023f8bda54848f@mail.gmail.com
c28de9b0810091155i71a95574qcf7c21e8da31386c@mail.gmail.com
c28de9b0810130909t6a3ee174r6e74b676e32429b3@mail.gmail.com
c28de9b0810131156u2766a3bco63d8b8da294c9cdb@mail.gmail.com
c28de9b0810141159y252cd90cm5242776eda3e7a14@mail.gmail.com
c28de9b0810150932l41e9330bx7c0b3444f17f2de9@mail.gmail.com
c28de9b0810211038v663152c6t6cc299baa102311e@mail.gmail.com
c28de9b0810211150h327d626dg93b832abfad50508@mail.gmail.com
c28de9b0810211545o3c2c7cbejc33b7c84c4d62f52@mail.gmail.com
c28de9b0810230726v5dc9e4c5s588bf9afc260abf2@mail.gmail.com
c28de9b0810231551u2dab9252i14d6d5b892c9defb@mail.gmail.com
c28de9b0810251537x48b662c8t10eb677d386beae@mail.gmail.com
c28de9b0810271616x457417edg370e3573a903671b@mail.gmail.com
c28de9b0810271618q58c313bcu9d04fb092bc7d21d@mail.gmail.com
c28de9b0810280844q4cd930c7ycbeb695bf199dec4@mail.gmail.com
c28de9b0810281606h392c9a50r627108507e433916@mail.gmail.com
c2998a010810140816g13d096eetf611493538b4a5cd@mail.gmail.com
c2a783556be510b8948568c786d9762b@mail.gmail.com
c2df5b00e4fdb14a885c57c8e863a36d@exchange.mit.edu
c30c9516caff2d4cb15c8f41bd015aee@namprd03.prod.outlook.com
c324e1bd719fbe469eb813e2ae4077fc@fleishman.com
c32c2bf1-8920-4562-9498-83379d3d92a2@hrcoffice.com
c3583a47a30a1f45b54421f3537df7bc@law.georgetown.edu
c37b9f4687bad48ad11b2de29f22496c@bounce.bluestatedigital.com
c3a02a02-0aca-4d34-95e5-4261f54124dc@xtgap4s7mta4376.xt.local
c3fa40b98db5f44a33d6fb872e5d1f90@mail.gmail.com
c4254684-d93f-4cff-aa72-af2253316c24@gmail.com
c44e2173.7c8e%david_sandretti@lcv.org
c4784f81.271bb%ddonnelly@campaignmoney.org
c4798cf509f8164ca88f23d8abb691010102c134@mbx025-e1-nj-4.exch025.domain.local
c47d6cc7.79a3%dmiller@campaignmoney.org
c5119875.1212f%joshua_mcneil@lcv.org
c52e0191.13ea0%joshua_mcneil@lcv.org
c540e851ea35d9428ec489b3d5692664@namprd03.prod.outlook.com
c5499e50.151a6%joshua_mcneil@lcv.org
c666ad9d.23d69%joshua_mcneil@lcv.org
c678034b-5627-4399-bdc7-5b80acdebf7e@progressiveaccountability.org
c79c559a7cd0aa746e7f94622ff4f0b2@mail.gmail.com
c81203f475123a9e28e9c42cd4c5c72a395.20151118043954@mail189.suw16.rsgsv.net
c864ad4a.35366%michael@huttner.org
c864ada7.35368%michael@huttner.org
c8652f70.35451%michael@huttner.org
c87d0338-d7f3-4f88-9b38-a48880f85e23@gmail.com
c8ff02da6e3b420485b9d4fc3d5d2797@kslawmail.com
c8obu0.4p1ap.o13bb.optout@e2ma.net
c954aa38c655c743b7fbade01fb689f512ff9cadc8@dbr-sbs2008.dbr.local
c_-cy_fr0nkwrlnfxxq6lkzlbtg@mail.gmail.com
ca+1chexl5aw226npnmynqkydevdomzhe9ofsn+w9jwaafmryya@mail.gmail.com
ca+c_h82i2pbugv4dkwdgabf6cx2xoubjw5a3zsw-elayipu7vg@mail.gmail.com
ca+k01qnulgy7emicuffaiyq+3ys7vl4rcs-z3hvtt930yb10oq@mail.gmail.com
ca+otjy8ufvy_h2+k6d+bb+qgaqou3spda2pn0jt9xo6su6sx_a@mail.gmail.com
ca+s+6pu0zthrjyesnj8xczuxkdx1f5yj8kefthmg7vsx8eabsq@mail.gmail.com
ca+z3wa0yg7g7kqbekxyke7q_wlvtyg8wyjesdoolvbhpnsleka@mail.gmail.com
ca+z3wa2wjieupvm5cyxjzf_1jms0yebnafc+tptwmqmdgqssng@mail.gmail.com
ca8d0ee01001271726q414d7febs294b66fe724e3e85@mail.gmail.com
caaewkfwc5mpgiaqdn2zbhjt5o3jp_rzwn2rscvcnuzrdwyyx1g@mail.gmail.com
caaewkfx88sj10cht8ge6zdjprcqh6hurr5g4btwutxzbddbu0q@mail.gmail.com
caaewkfxyt50vjh-hzyq-zk7ooqr_o+tqnk7ixb69apbdqzq7jw@mail.gmail.com
caaewkfxyz86dizf2nm9kxeznc-byifg7glpqf1syjv98_skg5q@mail.gmail.com
caaewkfyfuoev8mwsjpptp4eqe8+nquz7_qcuahwl4mn+hsrnza@mail.gmail.com
caaewkfyfv17ynpw+g-akgt-wot37mxm2khwof9s4q_txt7uivq@mail.gmail.com
caaewkfzd4yrgamfiluhomliefdkb6wylhaqtvkox9gfwc9vi7a@mail.gmail.com
caaewkfzkq4vmrxe8cvabcfpxoyrwlxk5vbck_3am41ufwpwzaa@mail.gmail.com
caaewkfzymini1zxmrw6dbudvstyxv_kqxwikc6aizod21okpjw@mail.gmail.com
caahtoqhy_jek5e7acreggym1usodrtqfowiojqjixheymarn7a@mail.gmail.com
cab5o6batgyy327ol4h9nthtqkw_v1bido-ucdrbc2gpvnvoufq@mail.gmail.com
cabd81j+flx5c+7wswm8ttouvecg3-olvjfuby_q4gtkdcoebaq@mail.gmail.com
cabd81jj96hm7ru8ntrp_5nd1wf+tyugc_5azbemd0rv0ampeyg@mail.gmail.com
cabd81jjh9g37gzw7uzjo2josevz4pn5kr3b5n3ia+fujmky00q@mail.gmail.com
cabd81jlgj8ar4a7wwzh5bhjb73l70g6j_cxtccedgmzzbnbazw@mail.gmail.com
cad0-q+qdqzdbilegqvztixm-vvpowful3zar33jnjffsntmsyg@mail.gmail.com
cad7tbaopevkpbhau_61wnssjjjwfkohulxghfk9belrtppt1ka@mail.gmail.com
cad7tbaphcyaas0sryua9stxarpmuxq0hi1jeymdy5vkeajxs1q@mail.gmail.com
cad7tbarxbo-h72tafbjomro_pwz1ybwy+0wkpe8r71fsoodwzw@mail.gmail.com
cadxwnccr4k1cb0qnwyykoozhw54kynq2axmk-98mgr7gscdasw@mail.gmail.com
cadzo9g21wxzvgd3ysei-4oovkbm2uzbupb44yjn12erkf4k5wq@mail.gmail.com
cadzo9g3kcbxpqe9mzuamymsebhoktbhuhjrfrr8k8u2nnzg8wg@mail.gmail.com
cae6fiq-5utzfzgpibhhx_k_mwrwzdexp_7agf1_cd6gzbpknla@mail.gmail.com
cae6fiq-a0kcgx01cwcmyeag5ilhnlyqvnxjs42cczfdwwkuxvq@mail.gmail.com
cae6fiq-axnxwdur1drrbtfnnytwkbwjvqiq79_cuhqr2w1nxgw@mail.gmail.com
cae6fiq-bjfbu8erp3xx18uwr0fqu0x3lztctnyunv6zrpd8wtg@mail.gmail.com
cae6fiq-ecrxhy7ubv5u_eent630chf6+2mi3fmgge_r5jxsysq@mail.gmail.com
cae6fiq-kum1y3dufo3tjbwte5j9urqd2nyfuueah2381brtyqq@mail.gmail.com
cae6fiq-kyj6t3cgg1n1w8bdwhj06fe8tmmps8o79e6aqyy_oca@mail.gmail.com
cae6fiq-nhhub3jnfdp1hl1udvstyazi+kpzhfs4jjmvesv-ysw@mail.gmail.com
cae6fiq-tm4w3cmsfvpofzof8uxvsbvmcbvx26ncmysmjbqjpzq@mail.gmail.com
cae6fiq-tqqtk-qmn5ueemg53z1s7x9uy5ntqydapym46zggppg@mail.gmail.com
cae6fiq-y9tyg6gcbwg+rxso5byd_uqol+-xd6v6mevgvddmtg@mail.gmail.com
cae6fiq-zpsmu9vvexqsd58uwg5jwkzau5-rdysp7rrcvlc06pw@mail.gmail.com
cae6fiq87sbxpqssh15+v2cmcmwv+aetssnrk4zcwws364gut6a@mail.gmail.com
cae6fiq8ap4_ioxv4d0tp8ijkxshf5htf4hgv3yu0cqzsjdfexw@mail.gmail.com
cae6fiq8b3
-dc0tq4x_-teqjaplwefzwhj8qy_fnbnfopmg+rq@mail.gmail.com
cae6fiq8c2skqkby8be-jjp9aogksng6poo3ylljbckttir8x1w@mail.gmail.com
cae6fiq8cgu0aouh-tos0dwgkzrfgxrcrnegebsjmnjjqnql+pq@mail.gmail.com
cae6fiq8cza9eoh7poo5+wtxq2jmm4+7uvtsscwt4kjq2z+lusg@mail.gmail.com
cae6fiq8hm9jwd8pywlvhusqegmm7ykduqjo5s9edy8oxhbahyg@mail.gmail.com
cae6fiq8tnergeavojxly10m8f_esbktw0gp9pxjhucswahouxq@mail.gmail.com
cae6fiq8uonlgjnjmnb1nnm0kc8ymxxxlaedi2-4aua1uq6_xcw@mail.gmail.com
cae6fiq8vtmuzwymfw1rju6ejhmttsyl4avq6ha-5h6dcwhcf7g@mail.gmail.com
cae6fiq8xaud5oo-km+tdy4yljrgfdre3y9atsjwomqef1owq4w@mail.gmail.com
cae6fiq9-gmn_t6dav1r_jajpzdmjigwhyywkxjff7qgeyj37qw@mail.gmail.com
cae6fiq96kfkgmd3wcvwr8lc5o8c5dvumyo_jwpu+abmno0ksvq@mail.gmail.com
cae6fiq997dje+pkbgj0hogl+t_v3djfjpzzlcwvatkque6v2fq@mail.gmail.com
cae6fiq9b6hlrbhkkvlyzhjvy-zagws15q-x+ox5201ieenbpga@mail.gmail.com
cae6fiq9ck51bntfxzmoejunvcx8cbycpqwshtfdkjctwjfzj3a@mail.gmail.com
cae6fiq9js_d0ljpezvyoo21vqjugrjjowgcbffypw32suh+d1a@mail.gmail.com
cae6fiq9t1vjpcmaw3uk53qcqzx+m2ei1jqq8a6uzhewa8kfd-a@mail.gmail.com
cae6fiq9uxj8nwnjzza_n_gkvaimz8ixan0auth9eqyddfqbzow@mail.gmail.com
cae6fiq9v-iad5e3mpywi1qvpch0z5u4y13-3p_zlaznxczhvua@mail.gmail.com
cae6fiq9xlpbjs1zcfqrpm294ojfa5e0-uydtooqprti2zhaoig@mail.gmail.com
cae6fiq_0x16vul4yi+be0_mtubfxycl3-fg_apbftlazj5gvig@mail.gmail.com
cae6fiq_9dl2evymeup4otv5c5rjrrxuugvynmeufrj9ns4csua@mail.gmail.com
cae6fiq_a_uwbn_4+p3kh6t1ym1xxdm-hkj-bxpcewuute+2ccg@mail.gmail.com
cae6fiq_fg6dmc6rqtmvzgv8nnyybsvhyveshfewyvua0lsocqa@mail.gmail.com
cae6fiq_od3aznwnviyegha779cobd8mdjkr84ahsmefun+xztw@mail.gmail.com
cae6fiq_s7z1yyu8u+1h_vo+u+ipvbbkmowndmur7+rxvkq3owq@mail.gmail.com
cae6fiq_uaywmwalsefdmxvustavkqtifuqbax1faj5pqesibaw@mail.gmail.com
cae6fiq_ujcegw+5osg4w+g00frasvuaecaeywswt8kcy5mf60a@mail.gmail.com
cae6fiq_w+-ze5asjxwycqg-tsedcaiywshfquw5j5cxpavo3rw@mail.gmail.com
caej1yxr_wjkj3w1mgw9szt3oxi79sq5wkebra0g-yjyncxcweg@mail.gmail.com
caemn5qkccby-6n11snxd+v4vbhcxjf+hciauavg4mnqarqqvdg@mail.gmail.com
caemn5qkdq3gxjw0hhzpcpmf_x8vtshca4hdjiy0chdni8pqhta@mail.gmail.com
caemn5qkhehftu7wjgtrk9kb3+3r9kuczdo8myd9h_rnr9uzv9g@mail.gmail.com
caemn5qkpwg9q4w7894fpdhc1e9zmpq-wyg7s7dttycdodxmpqa@mail.gmail.com
caemn5qm-vxjtodhmrz5igo0umdoafd9fom+f+5yv8w9u7unqig@mail.gmail.com
caemn5qm4lskd5b7ymcqppnqopnuh3aognf2da4nnwdtj62rbga@mail.gmail.com
caemn5qmfoojyxgltw1ekwjfrybn2ueyvc-ej9sfpjudc76ux-w@mail.gmail.com
caemn5qmh-io12utc+fzecrap+7hrhesgunlelwen7inhbgirjq@mail.gmail.com
caemn5qmoshr4bn_-kt8gpqu7shyqsdkd0resvz_st8rowof0zg@mail.gmail.com
caemn5qmsmgpjeszoeg1lcfcqu0-8_c3vemrnxrwu0qbgzej9lg@mail.gmail.com
caemn5qmu_aoyxihvsmsosiehcha6sum_9atnwwfsmgggygbwkq@mail.gmail.com
caemn5qmwuwjg6q+ourke8vfoxv_y-2aaqdzmrxvxt4cko-+jpa@mail.gmail.com
caemn5qnxi81++kwnyutbls_gezehgg-bmnuyh_xhmeu-mz2dgw@mail.gmail.com
caeoe_pqea10kgytmxp89skvcrex8jcfsg2mp9hmde5pti6qlnq@mail.gmail.com
caeoe_pqsg31bln3pvhxqu-r4xqf1pqbnyfqez-rsysoszrujea@mail.gmail.com
cafjsera5muwqhteb6vo4+98pu_vmzzot0nxxka3ubwj208cjwq@mail.gmail.com
cafzgkwe1uchphpnueljjv-odgw9576r5aisqeeozegpe_aoeig@mail.gmail.com
cagity4r-n7v_5hfbp6xhnxd6jugychgp74hswy6vcb57vvmnaa@mail.gmail.com
caglpf4c-gnx-zxyc66nqvc6u0frgb9adsz4vxsbxj2emwqckmq@mail.gmail.com
caglpf4c5rt7pdxcqq3fhun_4w6nvky2gjftgvcj7-5zwoy_feq@mail.gmail.com
caglpf4c6fxpwbmthjubcuhvukshvoawhxmduyhn1z3rr1a2usa@mail.gmail.com
caglpf4c8qozohsbdux4s0r5pxarxon9enqefq5v6ek5kuxgzva@mail.gmail.com
caglpf4c9k-1_8r_8m6t0wavfrek5ay0f9jdvwwsjw+9tpfsza@mail.gmail.com
caglpf4ca1zpcahkfajqr3n_9xtg0uvdai-_crt2kwzglh5vitw@mail.gmail.com
caglpf4cg9nn58a_3rgyvf_zhqokqcbjgunxfbdp_whgka2p6za@mail.gmail.com
caglpf4choitvbmtg03sdwo6ta2-tbunjudgaof0ftzua9znkoa@mail.gmail.com
caglpf4ck80lwgcn2gnbz5y27jcujx6bhjug306q+b3aeix3zkw@mail.gmail.com
caglpf4ckgkjq4tm-yfhhyqgsnruykasb23d7revnu1xhw+xkrq@mail.gmail.com
caglpf4cnk6azgws4mk8hskvgk_92tkrbssqp7v05rnxv3c6noa@mail.gmail.com
caglpf4csejwdk_xrcqb3kihi+tzjrbedqdx6qcvngk2mblwmqg@mail.gmail.com
caglpf4csuugcw8a85otnawn96jzxzahxzzoxeeeuvkk+2bs-ya@mail.gmail.com
caglpf4cw0t37taao7sww1yjwz-iguz2sb068q5u8hsfudnzatg@mail.gmail.com
caglpf4cx+ztrid9gqnc-w1udrhrqabujiv-fznvxiep_jmrz5w@mail.gmail.com
caglpf4cyz0fmxztf7qch8d6qtme7eohoasffcqkjqao9hdwg9g@mail.gmail.com
caglpf4czb-zpgjgmkwjtvszf3a1hwpzv6hta-dag8a3vwo+kjw@mail.gmail.com
caglpf4d15xcmpdfxthsu4e7t-p8oew8vr5zxagmbpf4wvfnowa@mail.gmail.com
caglpf4d3zc7lr0tbvgjbzcebtaapa0xfgvq0jrpf8ygf8jxy4w@mail.gmail.com
caglpf4d5kp3qkwaea-85lcyvhmisgqomshu36s0g7noabj8w+a@mail.gmail.com
caglpf4d6pwb_y9yt66tddockrtgwa_5xumcmstpchu9kcnjc4g@mail.gmail.com
caglpf4d9kk_dpcntewuq084owbrn1uxetk+novcuewl-rxu67a@mail.gmail.com
caglpf4dbw9nw+zlddhjq7ximccpwkgvmwdilwxco3zzjhia+oa@mail.gmail.com
caglpf4dcg8+dbx-jgc2tbdep9vnojan4agizofw-epjp4dc6aw@mail.gmail.com
caglpf4dd6f0rtrtkf8c+qfqrbxrm-hjfntf5tmhyqwxdsaarpg@mail.gmail.com
caglpf4dedtb-hfphb6zrasma7wnfkvfvwoaeukxdnzmukza0gw@mail.gmail.com
caglpf4dfivodqhs8yb4dpga-j115muboyaosrjj41+ewg8wmdq@mail.gmail.com
caglpf4dg7atxqjdedw_62avma8yjlv4u7xfolhikwbgj3rzdhq@mail.gmail.com
caglpf4dkh3y9gxttxsax-u67mro_rwuygnoupvp6lfdh-an-og@mail.gmail.com
caglpf4dkxfi4wbjpz+bce6ygsmmy57lzeij9hcypxty2zy1vbq@mail.gmail.com
caglpf4dpd0bqjqw+pnlde380s7vz_fi6wyqmzm3spc-nwweuxw@mail.gmail.com
caglpf4dq0n2thq4kefcnbwspzmdmspfyrojcscr_iay-bpmh2q@mail.gmail.com
caglpf4dshqs2ftk9cxprelpd1w4nnjzlhjhhr1gsbzpyjnrllq@mail.gmail.com
caglpf4dtgjwipw9e2r3k6edrinutma9tu9vseskpewzsvq7w5g@mail.gmail.com
caglpf4dtu0tic-dhcrpddlc2hx3jpszhj8sujghendowhxqw2q@mail.gmail.com
caglpf4dtzn20iesvesnappiz8bp_wvkolwmpdodfru63zyypvw@mail.gmail.com
caglpf4duavzhun+rw2m2jkiooauldc4noqznhu45-mdvzsvzpa@mail.gmail.com
caglpf4dvdttlxy1lsy1+9uvbkqf4lehxnqf6kv0nxsc9enb34g@mail.gmail.com
caglpf4dx3s5b-0setcqmn6jf8oksj66rvt3txhwuly3occ9esw@mail.gmail.com
caglpf4dz4bvebltse--9kwayyrpw-_qttnybumzq66eookezxa@mail.gmail.com
caglpf4dzxnug1dmanghenzid7_duja3masljczg5p6_q-rkr+a@mail.gmail.com
caglpf4e+55gov0lenuqu4cbnuxuii9sjvtj9khpj_ak3oqhiwq@mail.gmail.com
caglpf4e-uk35qunrhpwco6wzlgn3xsxk2cx_mxzimmvqkxjyva@mail.gmail.com
caglpf4e0_ibzvtysjy9d4h3o4k9n2p8ejv+1fg3s-tup4ik5lq@mail.gmail.com
caglpf4e2p9rr+l38erpmgqm4_tgzsm2gp8ezu_8ybuxy6i3bwq@mail.gmail.com
caglpf4e57v+soe2ppc1wwx14minm71p3r0ra6pp-kn-8nbtk9q@mail.gmail.com
caglpf4e5mrw9hocmjcq660qqfjsz_jv6whkdokr58vd9nrtyuw@mail.gmail.com
caglpf4e5of7bmyp6kakufl4u9nukhw1qyvybgdxnt3jqnrxh9a@mail.gmail.com
caglpf4e5rqyjzvguhesgzirjnkxddjkwq6kef9bnfuxszjycoq@mail.gmail.com
caglpf4e7vuapvsjqy6mzhcgjmtcbxzmhswbdkubq_ddt_y8cdg@mail.gmail.com
caglpf4e9-cnm5sbwlqetuzhlw5w2awl466_barj1n6n-fgfjuq@mail.gmail.com
caglpf4e9vpatyv6cnfy7+6_gxdg8bhr8omp4feiz2hfvrk6ola@mail.gmail.com
caglpf4eapjfg0xpsug16tkrccppcwjhhfzyx_jkgkiefreiedq@mail.gmail.com
caglpf4edcui1sd4bdsj7tv7o9fj+xuysrg_6qepzogctqmfxfa@mail.gmail.com
caglpf4ef99wofjegefd_wmkp3qskua9y7g+zdusbnspzqugreq@mail.gmail.com
caglpf4ei9azdr8tdpvfjufncmthopzydwtvu2cncxdcyyb33yq@mail.gmail.com
caglpf4eld4qxucr8zqbocwdzyyxiqmsvnzhwqgp_sdnts+9jha@mail.gmail.com
caglpf4elzxszmwnqt6-ch8o7nvrro9obfkk7db1psyakos7avq@mail.gmail.com
caglpf4eos+c6bmb6mb5zuonofxqkbm5pkmsjosj7ttyfp59ecq@mail.gmail.com
caglpf4epfdhcfovhhaz7lrzfk_2xm--ktbmqso5vyb1vgem+qg@mail.gmail.com
caglpf4er72hazbk0sjaccnqsnrpqsm88dvqae0ylca+yya+h3w@mail.gmail.com
caglpf4eswsv5an2nysy+o+qorp3rr8x7xgbcb3a6rpjabku7mw@mail.gmail.com
caglpf4etkctghkoodkuudesr7ftfonci_di5-bvs+gc2eyg9ww@mail.gmail.com
caglpf4eumaozdoawho5hjwxty2md+yw8xtpalgkmjpdfylojmw@mail.gmail.com
caglpf4evypmqp5xbtg_9c-yj8p8bojp+yt968xobboq7at2r8g@mail.gmail.com
caglpf4exceuuhaf-k86-gvpqlesgvq2c9jxzndm-dzmoeh_uhq@mail.gmail.com
caglpf4extjufckocb9hvavhnvkd0442uppkgnvagrktcrb7ibg@mail.gmail.com
caglpf4eyu2vhqquyyh5veuksuqczmsexnlabv4g2ajnnfvz3bq@mail.gmail.com
caglpf4f+9cx4j3wdgj+-rdrnhd4ckgjbtbgshwu1pzd340hs-a@mail.gmail.com
caglpf4f5mhufedyjazytdr5ph192ucuvy9y29qrjztr891vama@mail.gmail.com
caglpf4f85ukbpnmpcut0gap3x8o5cypqhdncj_p+f_pmmogkgg@mail.gmail.com
caglpf4faaccpu0s9otvhgggdm5s-gafo2kozetnn5sscchcjfq@mail.gmail.com
caglpf4fcjn2w2ugvkjdrv0re5ojugoue_nhjaru1njey6jujkw@mail.gmail.com
caglpf4fdywj-vc1mururbv4v5qndmqzl-wfk8poakpktmcbqoa@mail.gmail.com
caglpf4fewx1+1xj2oa6-iqjrtjutjyktwcxq6skec54583cxag@mail.gmail.com
caglpf4fkiez70cfbk6n_m4_uua5qwl6vrkdq6aqqfhxkmfdipq@mail.gmail.com
caglpf4flhksho+ncp+brf5zj3qatfcu_g+i3m54w0chvavdidg@mail.gmail.com
caglpf4fnw0pwmzpwn2mvbqmhwo0zxnnnmvxrsegamjwxh662oa@mail.gmail.com
caglpf4fuphak8z7xmuafgwm765xohjxvmgebe2rgzjta54q8va@mail.gmail.com
caglpf4fw+3fuj8taue+dec_0pvnzjw_w7z7xgu0er3u7yxfoow@mail.gmail.com
caglpf4fwakpaubhjzgk2zc2urygbsg7uh61_ov3-nhtvvkxzpw@mail.gmail.com
caglpf4fy2_b0_qp+tw8xeb6rkcytuoqufwtv1o3pc7pkd0xagq@mail.gmail.com
caglpf4fz7wsncjf6d6xtyokrgl9w3_2jxprvpwhsbx3zw4e0nq@mail.gmail.com
cagvmb-advvurxdovqcayn13jopzlbkknrqgcbnbjztu_vvvtcg@mail.gmail.com
cagvmb-amnfscykwgaw5eoz+ymioba0fq3uy_rbzqhggybrpixg@mail.gmail.com
cagvmb-yb4dz8vvzt+nkfdjwfqq_sfrfzzdmbs-td8ptutktltg@mail.gmail.com
cagvmb-zh2_zvh5lhjffvbvhrtq0uqr_psto9auaagff7yougfa@mail.gmail.com
cagwpajnq+hko4lj4zkupngpweocqyrujhufxhhsdp95mrhrjkw@mail.gmail.com
cahb1ck+przrg5garn0vvj8qqxywysjuqct5nhxuuymefwecynw@mail.gmail.com
cahb1ckj-codk2-cfm8w2hbrwghuhdfunpmgchhph+8vukx2evw@mail.gmail.com
cahb1ckkydg1zvq9ae+mhdywdrytaeoxqfiso6hkonh9yrihehq@mail.gmail.com
cahb1cklotqywsfdme+hebhm7_ce4dnioacdx3yqz9dghumo7xa@mail.gmail.com
cahdaebawlv+ev4zgwkvkd8mp7prexky2dkdfdiyxuc4lpbf18g@mail.gmail.com
cahetmvmbhtftxvl7uqnphvja_eyehsqlb4u0xwuacnsrv2dgoa@mail.gmail.com
cahos2sjr-jphwmgkzziemoryfhclcyeemc12jv9zds25ejvqfg@mail.gmail.com
cahvxgn5xyokh722x_du1-kj1nu8xnm_uotfchcjv_x9qxvjn-q@mail.gmail.com
cahvxgn7khn-rbmxawahzj1wntgjx41+5izw-jqu1y6bn8cm78g@mail.gmail.com
caitlin@grunwald-communications.com
caj4g15vhzmkvxvzqwrrmk8-amzumvfvph9ncurhjsuptgwqihq@mail.gmail.com
caj4g15vp1y8xnb2p9twva0yl6j-+uyax8bgrbpkvezfquaudqg@mail.gmail.com
cajkcx187rmvbv9rchkazbkthruaxva5szy+whlh_v-6slcdeog@mail.gmail.com
cajltek09ehzdwepmi2ujvrbr-5e5f77b4guuoyqduqdp4n4aya@mail.gmail.com
cajltek2b7xks5jyob13xn7ykkpqqnfqeyrmzew+kgi0mzvuxpa@mail.gmail.com
cajltek2gagjxhqsgfk3tzr0-sau0ze0nhx5nkrgmxuohh1o1rw@mail.gmail.com
cajltek3htexgbdeyypbk5mlqmhn_jmx_nr9jjbekdyl1ywo3jw@mail.gmail.com
cajndscef3rytv-pdbf1fgzp1wpvrwwpqhkzjszign1mj4kksba@mail.gmail.com
cakekdpwpxt-ec+cdvongxwvkz39fd76zxtzynwp9hbtkgsfz2a@mail.gmail.com
cakm1b-84z55ofg2pu3_rd+touo_slxtzkjp4-u0rwqyx75q_wq@mail.gmail.com
cakm1b-85eopb0k5vjkj-k4p6iw8tohdcwj142g9fecrrnaw27g@mail.gmail.com
cakm1b-8ck+auzqzxnkr0cqzzsvbl26c0zmgbnytupdzhp0coea@mail.gmail.com
cakm1b-_4gezs8a27593iszhi1ts1fsvvdx55xyexegwqbe-eaa@mail.gmail.com
cal3dchivs2a417q2j4pe2watm2s_064-ab5j8xidxssb1prnzw@mail.gmail.com
calk44abuyjuwmcjhqboiwycojy0rn0y5upqqnm81anrpx+nuaq@mail.gmail.com
calk44adopfvhrzdf2z3yfzizzhsetcqrnkeqkaytyv1rd5+zhg@mail.gmail.com
calv_k1qw1pcppznpmvyxop_oasqjssqqqe6guxnzvky-sjd1xw@mail.gmail.com
calv_k1tyxewmorhyu2obzzc5wssodqbjc2j0mw+cvmlcj1gwyg@mail.gmail.com
cam7ofynv0ghckku1wv02gl_g+q5ind48plrtjcy0jjardiexfg@mail.gmail.com
camayd+6jpokfh1cnoyshk+kn+clntkum-04h1o5h3xiyn83c_g@mail.gmail.com
came8pxwc+yt6yyl1eextq23gxir-2pcmrcyhpqpsktpnvpbu5q@mail.gmail.com
came8pxwfmr4uebz5vr62fzapn8msi-yjn26gwv1cgvdqsvg72a@mail.gmail.com
came8pxwjfvu1xwcexzta4+e5yfz6tw_h_fjbyqw_dt6gpl7aca@mail.gmail.com
came8pxxj4u6vg_rxtk88lbniirobhfnlkdt9-covpdathggwma@mail.gmail.com
came8pxxntchzuhy76v7zenlt30f-magdyikfxgkg1uud_oowtg@mail.gmail.com
came8pxxsjy91de56gfhmw9ykcdtjko9xkf5gcyhhdrdqq4ivla@mail.gmail.com
camgpaatt8pq2xqbsxa+2tn48gj0ymubrdv1q85m4h58kmrj7cq@mail.gmail.com
camgpaavufhnwduavdmn0mthcr_e5yvhgbsjnyxsuf5kpwfqona@mail.gmail.com
camhpea-logk9tzs5el3spbj3w+fcjsuzqyyxj8kbyhxirhgk1g@mail.gmail.com
camhpea8_wrpwf0f44sk1t7+mozg9s21pfarvzakkazj7aofdjg@mail.gmail.com
camhpea8busmf9o4pmjgnrt0esifye0+w5ff2+bjykoctavahkw@mail.gmail.com
cammie@progressiveaccountability.org
campaign@googlegroups.com
campaign_feedback@twdc.com
campus-bulletin@knox.edu
can@americansunitedforchange.org
can@list.americansunitedforchange.org
can@prochoiceamerica.org
canberd4e3rs+qapqq2b7m9bp31edqvgnz6fciyasuk2snnrycw@mail.gmail.com
cano+tmcht39q2qjgq74p0o2xvppb71swvnsastkzb3r8y_0jrq@mail.gmail.com
canoirv8f-dch_lkhtfsooikt1yqfqh0wzngvko57hf87ffoqga@mail.gmail.com
canoirv9voo87eq+49mxgxrrom5guxnkp0ncal5yblthibfqvha@mail.gmail.com
canqtg_mhsa7lbfpvkb1pv2ww6k_ofzdjz8s7vknyse9dg-kuag@mail.gmail.com
canqzgl_wecb2gfg_shpsecffnsjvbefupcqstq237daarfngtw@mail.gmail.com
cantalun@law.georgetown.edu
canu9wn4h01qazba_zy4ex8rbrivt9nynemdjdzrvbbi9zwo+0a@mail.gmail.com
canu9wn4vkazmwbpsdhvtdvom9ddb6cxow2uvf1rpzjakglzvlw@mail.gmail.com
canvypvb32fjdcoq2ade2c_srzgpzlb5mwdajfdkcr+llgzn7sw@mail.gmail.com
canvypvbohip0mnvqjvylup4x+w2gdhoyxwpg36twbrxi+re5dw@mail.gmail.com
canvypvct9hr3wkzajjsxn8wx+kdxd8wdf2hxbq921jjtvp6bxa@mail.gmail.com
canz2gv5ugtcagctjac6e-wesh_3rv1z7t1drkd-6bycyw-9d2q@mail.gmail.com
caoa7na8alhzj4zo7d1ti083l53ytxiqxakmg3qhobz3o3alt5q@mail.gmail.com
caolo1-k-3ye4qbyhpxegpn-q0ntah841vy+tg6yx_u5zxcj2cg@mail.gmail.com
caolo1-njakblmwshuyesu37tnz71x8xlsdw0jc8fz55bej-m2a@mail.gmail.com
caolo1-nlfeqkuvusc1py+prfd+zoinzxgakmgh5b0qe46lmkqw@mail.gmail.com
caovyfpamtv1ry8+fv3q+1fpqh8l_a+nqure6gfnrtujpez_m9a@mail.gmail.com
capdezwk9aqzmz_rouxqngbhqucti76vwjujr-pe+9nmzaewazw@mail.gmail.com
capriciamarshall@gmail.com
capry+5+6zhh99vjjvpjemosonj3djq2o+tvbhlo+gqdadqa_ya@mail.gmail.com
capry+5+budtor7her-ytzqcowo8vbz87epxlgyfth9xmvftydq@mail.gmail.com
capry+5+fc3rzanidyrjqjjp7bitdboen1ionrpqr+c3vyx++dw@mail.gmail.com
capry+5lgcqqe_smsylfagpfbn5x55tt622nbfk+evycwyrauug@mail.gmail.com
capvzjh+wnvdaf0vps-wkqvjvn990v4z_negumkbt34wdgv7ria@mail.gmail.com
capvzjhjkp9gxybxw2r2m66xmwswarr+ep0fd8uepszxum9bhpa@mail.gmail.com
capwqm5e8soo6nv8z2f71sluufqurxp5ocbrarpeo1d_8vk78oa@mail.gmail.com
carawg0bhz1tbadwuweebqiivlzvbwbva1ndc1garqsbaevbaiqbwqraxbtscl5oug0c@bounce.bluestatedigital.com
carlpage@gmail.com
caroline@lcesummit.com
carolyn_wu@apple.com
carolyn_wu@asia.apple.com
carrk@hillaryclinton.com
cary@thebigtv.com
catforrester@google.com
catherine.whitney@skadden.com
catherinehand5@aol.com
cb107a8156db5e4ebec2bb86e472b7ef@mail.gmail.com
cb5e9746-a931-414f-bc8a-233b85649801@gmail.com
cb9da348dfdedf4a8bb6a02d5162550a10d27ec9f1@nygex7mb3.stbglobal.com
cbaker@hillaryclinton.com
cbdcc6e9070f90d0d46cf8f89f68ba6f@mail.gmail.com
cbenton@deweysquare.com
cbf393024ca811fb99d019fd23ba8318@mail.gmail.com
cbg@cboydengray.com
cbrowner@thealbrightgroupllc.com
cbutts.obama08@gmail.com
cc1286ec4fab234a6c308c0e3ac9a334@bounce.bluestatedigital.com
cc2fa3b6.4e2a%zshaikley@clintonfoundation.org
cchase@hillaryclinton.com
cciorciari@hillaryclinton.com
ccom@indiagov.org
ccroft@progressivemediausa.org
cd4d4dd1.b7d3b%hannah@presidentclinton.com
cd741ef5be8fc54e905e6884df4fdc38d29dd7@dc-dag-03.office.virgin.co.uk
cd7ff.ab94993.39afb223@aol.com
cdb3fafd0807011933u5bcab5dar56ba882e8e96312a@mail.gmail.com
cdb3fafd0807031858j476b4afby840a6639315d7dcc@mail.gmail.com
cdb3fafd0807031900l3bbff880h1fa40e0c121eea96@mail.gmail.com
cdb3fafd0807091856p701eb220ofb90a2b281f3c2b4@mail.gmail.com
cdb3fafd0807091858oc8c605cy1aef35d3b03fc32c@mail.gmail.com
cdb3fafd0807111850q404e8406i6f07524becd6683d@mail.gmail.com
cdb3fafd0807111853i412716f3w84b89f5a568206b6@mail.gmail.com
cdb3fafd0807231938j59f9cc14t9fae8d90407d9bce@mail.gmail.com
cdb3fafd0807231939i66bb4335he123543af7e48ab9@mail.gmail.com
cdb3fafd0807241838x7e33321au84a81378d662d64@mail.gmail.com
cdb3fafd0807241840x4ee86b21g6392ec5cfa8b031a@mail.gmail.com
cdb3fafd0807251916k4e22bc42pf481e091be51bea4@mail.gmail.com
cdb3fafd0807251920o2d4c62e5ta6122bd00ccc12bc@mail.gmail.com
cdb3fafd0807271112n4e99cd79pbe67084393e8a95@mail.gmail.com
cdb3fafd0807271114r62e66e85va5b9f9fb469f0eb4@mail.gmail.com
cdb3fafd0807281933ic82010bs23b7412b816b8d2@mail.gmail.com
cdb3fafd0807281935v3582b9b1g456c0963762aed98@mail.gmail.com
cdb3fafd0807301906g48dfedb6j47f4c00ada8c739c@mail.gmail.com
cdb3fafd0807301908l6e19d33od730cf90eda50cc@mail.gmail.com
cdb3fafd0807301927v51ab627cjae4b638fd95160e0@mail.gmail.com
cdb3fafd0808050746r7f51984cn83cf8a4d7878ba6c@mail.gmail.com
cdb3fafd0808050747l461b7a0dmd616769afe765037@mail.gmail.com
cdb3fafd0808060854i55e7fffagb92a3e9e5b7d7526@mail.gmail.com
cdb3fafd0808060855u138c2c96qdc196a3e5a93a8f0@mail.gmail.com
cdb3fafd0808070908y1261493dv998732fd3ffb1b19@mail.gmail.com
cdb3fafd0808070909x441a1e89yc89f2266dbf6746d@mail.gmail.com
cdb3fafd0808080856h3307bd75vab7f4b6a95377663@mail.gmail.com
cdb3fafd0808080858i1afa159h401fe7b12857555f@mail.gmail.com
cdb3fafd0808241047y61dd4eacl820f88da530ed284@mail.gmail.com
cdb3fafd0808241050t20a7ff7codb369fb21a6e30ed@mail.gmail.com
cdb3fafd0809162034u366a7508rec6482b78a1d3dd2@mail.gmail.com
cdb3fafd0809162036w9873039t766cf8a3903e7759@mail.gmail.com
cdb3fafd0809290902y7c7f9bb2p8dd5cf6fdef39c48@mail.gmail.com
cdb3fafd0809290904p27812505n5783a9141c7c9742@mail.gmail.com
cdb3fafd0809301003o787d71cqbe8b8d26af087b14@mail.gmail.com
cdb3fafd0809301006r4ab5bc9ej430cb3ee9804db62@mail.gmail.com
cdb3fafd0810221011v5bf30a3di958116b5bf0b740e@mail.gmail.com
cdb3fafd0810221013i5fe4064yb1c678ca42acb9ab@mail.gmail.com
cdb3fafd0810230906i4acf5561o5ac1edbffd764623@mail.gmail.com
cdb3fafd0810230907x1cab69dfjffc7a6cd75a1becc@mail.gmail.com
cdb95154-8c76-45fe-9675-3a7d72a33cac@bsgco.com
cdcanreportlist01@rcip.com
cddd9704-d3c9-4716-8e1b-ab272f56ab3d@presidentclinton.com
cdlgkajpvqeuyvghwn9ccvkotrxhi4obsw@mail.gmail.com
cdr-membersxchange@yahoogroups.com
cdumas@who.eop.gov
ce54d44d-b7be-45a1-9b51-1981e41f3ec2@manatos.com
ce7d951b73aa03379243bdcb3590343b@mail.gmail.com
ceaa507d-3606-418a-89a7-0bae5ab1df14@gmail.com
ceco@indiagov.org
ced14ef8-f205-4f67-9273-43f6ecdd76d0@presidentclinton.com
cedley@gmail.com
centerpeace.org@mail128.wdc02.mcdlv.net
centerpeace.org@mail13.atl161.mcsv.net
centerpeace.org@mail130.wdc02.mcdlv.net
centerpeace.org@mail146.atl21.rsgsv.net
centerpeace.org@mail147.atl61.mcsv.net
centerpeace.org@mail155.atl171.mcdlv.net
centerpeace.org@mail164.atl171.mcdlv.net
centerpeace.org@mail164.atl61.mcsv.net
centerpeace.org@mail169.atl171.mcdlv.net
centerpeace.org@mail172.wdc02.mcdlv.net
centerpeace.org@mail175.atl81.rsgsv.net
centerpeace.org@mail183.atl81.rsgsv.net
centerpeace.org@mail186.suw14.mcdlv.net
centerpeace.org@mail188.atl21.rsgsv.net
centerpeace.org@mail190.atl171.mcdlv.net
centerpeace.org@mail191.atl121.mcsv.net
centerpeace.org@mail191.wdc02.mcdlv.net
centerpeace.org@mail192.wdc02.mcdlv.net
centerpeace.org@mail20.us4.mcsv.net
centerpeace.org@mail200.suw14.mcdlv.net
centerpeace.org@mail208.atl171.mcdlv.net
centerpeace.org@mail215.suw16.rsgsv.net
centerpeace.org@mail217.atl21.rsgsv.net
centerpeace.org@mail222.atl21.rsgsv.net
centerpeace.org@mail3.wdc03.rsgsv.net
centerpeace.org@mail34.atl71.mcdlv.net
centerpeace.org@mail34.suw17.mcsv.net
centerpeace.org@mail36.wdc03.rsgsv.net
centerpeace.org@mail38.atl11.rsgsv.net
centerpeace.org@mail42.suw15.mcsv.net
centerpeace.org@mail44.suw15.mcsv.net
centerpeace.org@mail46.atl71.mcdlv.net
centerpeace.org@mail48.suw11.mcdlv.net
centerpeace.org@mail53.atl31.mcdlv.net
centerpeace.org@mail54.atl51.rsgsv.net
centerpeace.org@mail65.suw15.mcsv.net
centerpeace.org@mail66.atl31.mcdlv.net
centerpeace.org@mail68.suw11.mcdlv.net
centerpeace.org@mail69.atl31.mcdlv.net
centerpeace.org@mail69.suw11.mcdlv.net
centerpeace.org@mail7.atl161.mcsv.net
centerpeace.org@mail71.atl111.rsgsv.net
centerpeace.org@mail75.suw11.mcdlv.net
centerpeace.org@mail77.atl11.rsgsv.net
centerpeace.org@mail82.suw11.mcdlv.net
centerpeace.org@mail82.suw15.mcsv.net
centerpeace.org@mail9.atl71.mcdlv.net
centerpeace.org@mail90.atl161.mcsv.net
centerpeace.org@mail90.suw11.mcdlv.net
centerpeace.org@mail93.atl71.mcdlv.net
centerpeace.org@mail96.atl161.mcsv.net
centerpeace.org@mail98.atl71.mcdlv.net
centerpeace.org@mail99.atl11.rsgsv.net
centerpeace.org@mail99.atl51.rsgsv.net
cf1.62ce4baa.38219661@aol.com
cf588fa094fa2c40ba80fb72948f2a31139bfbb2@sf-exch01.sandlerfamily.org
cf588fa094fa2c40ba80fb72948f2a312f91df@sf-exch01.sandlerfamily.org
cf588fa094fa2c40ba80fb72948f2a31fc86ae@sf-exch01.sandlerfamily.org
cf672ec4193870990c256be27f5f34da@mail.gmail.com
cf6a3329ff05b0dca52f30715010d747@mail.gmail.com
cf7bf65f.32361%dschwerin.hrco@gmail.com
cf7d9ec3.32630%dschwerin.hrco@gmail.com
cf7dbd6e.326a9%dschwerin.hrco@gmail.com
cf87455f.54ff2%jbash@beaconglobalstrategies.com
cfaa1317.364c9%dschwerin.hrco@gmail.com
cgdxwajtvq1wagibagbqvlqougsnvmxzdvfctuzbuqewevd1bakhxqkdu1pc@ofa0.bounce.bluestatedigital.com
cgdxwajtvqwbb1eavfybbwbaulcdvq@bounce.bluestatedigital.com
cgdxwajtx1zragabufifwfopbgfrba@bounce.bluestatedigital.com
cgdxwajtxwabvghraazwufbdbqzvdg@bounce.bluestatedigital.com
cgs@geneticsandsociety.or
cgs@geneticsandsociety.org
ch@dixondavismedia.com
ch@hillaryclinton.com
chadley@americanprogressaction.org
chake@gmail.com
chake@hillaryclinton.com
chall@brookings.edu
chareby@aol.com
charlie.baker@deweysquare.com
chbook@hillaryclinton.com
chen@eq-cap.com
cheryl.mills@gmail.co
cheryl.mills@gmail.com
chh4xuu45obarbd_kztzdo2wwj7sm-pj7pw@mail.gmail.com
chicks@hillaryclinton.com
chlosberg@fwwatch.org
chogan@ceip.org
chowdhry@ricehadleygates.com
chris.stone@opensocietyfoundations.org
christina@drbronner.com
christopher.miller@benjerry.com
christopher_m_kirchhoff@nsc.eop.gov
churley@americanprogressaction.org
chw9@georgetown.edu
chwerin@gmail.com
chwerin@hillaryclinton.com
chwerin@hrcoffice.com
cich@hillaryclinton.com
cieorell@gmail.com
cindy.vanegas@huffingtonpost.com
ckcasey@louisacomm.net
cker@nytimes.com
ckkang@keaf.org
ckwalterpoza@progressivemediausa.org
clain@hillaryclinton.com
clara@lces-environment.com
clareywalker@aol.com
claudia.konyen@gaisberg.eu
clay_a_dumas@who.eop.gov
clemieux@cleanwater.org
clinton-editors@bulletinnews.com
clips@hillaryclinton.co
clips@hillaryclinton.com
clq26m3sc33c4hybyp8tkq@mail.gmail.com
clu@barackobama.com
clyde2016.com@mail143.atl101.mcdlv.net
cm.000004.vujijl.otlyhykh.i@cmail2.com
cm.011504.tjthhrt.otlyhykh.i@cmail2.com
cm.013005.ttddhhk.otlyhykh.i@cmail2.com
cm.013348.jyurljk.xdtludjy.i@cmail19.com
cm.014006.eckld.otlyhykh.i@cmail1.com
cm.024503.tkyhlly.xdtludjy.i@cmail2.com
cm.030003.jttknl.otlyhykh.i@cmail1.com
cm.030004.jkhjtty.otlyhykh.i@cmail1.com
cm.030005.iykrtrt.xdtludjy.i@cmail19.com
cm.031503.ijkdlty.otlyhykh.i@cmail20.com
cm.031504.jtkyjrl.otlyhykh.i@cmail2.com
cm.033005.jtdhad.xdtludjy.i@cmail1.com
cm.040004.jhlduul.xdtludjy.i@cmail1.com
cm.051104.vuytit.xdtludjy.i@cmail2.com
cm.053004.drtrtuy.xdtludjy.i@cmail20.com
cm.080009.tlktlyd.otlyhykh.i@cmail2.com
cm.230003.dkuutlk.otlyhykh.i@cmail20.com
cmbrowner@me.com
cmcdonnell@albrightstonebridge.com
cmills@cdmillsgroup.co
cmills@cdmillsgroup.com
cmlxqbqcs6nho2s0absvzpnbo6tjss0cnrc+hded8g@mail.gmail.com
cnfj17dgrr3bt4jzizphfnfxd+eq@mail.gmail.com
co1pr05mb4279d0a7fc125750632c9ccdab00@co1pr05mb427.namprd05.prod.outlook.com
co1pr07mb10937df43df15bf5f1fc81f93fe0@co1pr07mb109.namprd07.prod.outlook.com
co1pr07mb109f953e147867e9720d8e2933d0@co1pr07mb109.namprd07.prod.outlook.com
co1pr07mb11025c13ab9382c07cd2d4893d90@co1pr07mb110.namprd07.prod.outlook.com
co1pr07mb1106f18f12707f2fda5384c93ac0@co1pr07mb110.namprd07.prod.outlook.com
co1pr07mb110785d24f73adad13fb6e8934c0@co1pr07mb110.namprd07.prod.outlook.com
co1pr07mb110a6e2439caca3eb93cc9893af0@co1pr07mb110.namprd07.prod.outlook.com
co1pr07mb11121fc6d2378d522911bba931a0@co1pr07mb111.namprd07.prod.outlook.com
co1pr07mb111cf4fadcd715f61c60a2c931c0@co1pr07mb111.namprd07.prod.outlook.com
co1pr07mb111f71a80963b98b1f3f32e931a0@co1pr07mb111.namprd07.prod.outlook.com
co1pr07mb112e1fbb154ade68748dff193af0@co1pr07mb112.namprd07.prod.outlook.com
co2pr07mb53794bb1f1c093218e2d47d93f30@co2pr07mb537.namprd07.prod.outlook.com
co2pr07mb537a7a3813ce9d88962df1b930e0@co2pr07mb537.namprd07.prod.outlook.com
co2pr07mb537b0ff3106936f39cae5e3931e0@co2pr07mb537.namprd07.prod.outlook.com
co2pr07mb537d3098a4458347684a5fc93200@co2pr07mb537.namprd07.prod.outlook.com
co2pr07mb5381c0e4c48a545a526ccc0b81b0@co2pr07mb538.namprd07.prod.outlook.com
co2pr07mb5384e9b49ff2dc42e592e37932f0@co2pr07mb538.namprd07.prod.outlook.com
co2pr07mb538a75d0e9e16e39bb3065993fd0@co2pr07mb538.namprd07.prod.outlook.com
co2pr07mb538b7d8e8a40609c64c3f4593290@co2pr07mb538.namprd07.prod.outlook.com
co2pr07mb538c1c39283be2a666039f293440@co2pr07mb538.namprd07.prod.outlook.com
co2pr07mb538c3bfb60901c9c7fe360793ef0@co2pr07mb538.namprd07.prod.outlook.com
co2pr07mb538fb9afb399dcba4ca908b93d80@co2pr07mb538.namprd07.prod.outlook.com
co2pr07mb5396c690361e5272417ceb393480@co2pr07mb539.namprd07.prod.outlook.com
co2pr07mb53989be51b7ce5511d7891793210@co2pr07mb539.namprd07.prod.outlook.com
co2pr07mb53990ad22f958a639465c6793d00@co2pr07mb539.namprd07.prod.outlook.com
co2pr07mb539a6a399d1f677d270d65893120@co2pr07mb539.namprd07.prod.outlook.com
co2pr07mb5400c56e92bd18313910145931e0@co2pr07mb540.namprd07.prod.outlook.com
co2pr07mb54012aad3ae52265788dfbb93fd0@co2pr07mb540.namprd07.prod.outlook.com
co2pr07mb540df6a7b67f0f7895ef30b930c0@co2pr07mb540.namprd07.prod.outlook.com
co2pr07mb540f68f5e688091716080ba93d30@co2pr07mb540.namprd07.prod.outlook.com
co2pr07mb553c6645fb95671468cb8c593070@co2pr07mb553.namprd07.prod.outlook.com
co2pr07mb5558598c75b2cfc9b34d1a993260@co2pr07mb555.namprd07.prod.outlook.com
co2pr07mb555d05a41dc28a39bb8fcfb93110@co2pr07mb555.namprd07.prod.outlook.com
co2pr07mb555fcc545653e3d7d0373fd934f0@co2pr07mb555.namprd07.prod.outlook.com
co2pr07mb633baea4dbf8066758fa2c093bb0@co2pr07mb633.namprd07.prod.outlook.com
co2pr07mb63455701308a039ff8f9e4f93ba0@co2pr07mb634.namprd07.prod.outlook.com
co2pr07mb6346640cba25f14958b231c93bc0@co2pr07mb634.namprd07.prod.outlook.com
cody@riverstyxfoundation.org
coldwar@wilsoncenter.org
colin.h.kahl@gmail.com
colin@ewg.org
comments@broadfoundation.ccsend.com
commhouse@googlegroups.com
communications@halifaxtheforum.org
cone@abc.com
connollykeigher@gmail.com
contact@clyde2016.com
contact@hudson.org
coordinatedeffort@manatos.com
cotero@abilityfirst.org
cpress@dnc.org
craig@minassianmedia.com
creamer2@aol.com
creamer@me.com
creynolds@gpg.com
creynolds@hillaryclinton.co
creynolds@hillaryclinton.com
cribe@hillaryclinton.com
crlbua8mpzkbrw_op4uxbxmkdds+-vwm31a@mail.gmail.com
croberts@albrightstonebridge.com
crohlfing@ostp.eop.gov
crr@hillaryclinton.com
crummy@denverpost.com
cshubick@energyfuturecoalition.org
ct-eucnfd7unszoqcozgojboha02d37rww9savla@mail.gmail.com
ctate@mcclatchydc.com
ctrallstaff@americanbridge.org
ctrfriendsfamily+bncbckzb7f6qqcrbd5r52pqkgqe3mul4ba@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb27yt2pqkgqexxyxajq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb2mhvwqakgqeb7ptvfa@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb2mpzopakgqerxmfyzy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb2ndw2qqkgqezajy37q@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb2oh42oqkgqefknm2uy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb2ooswpakgqe2q7h4ui@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb2wfqcpakgqerncofyi@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb37v2opqkgqeqn4zskq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb3fvqgsakgqe2cmss2i@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb3gm7spqkgqe2lmnzyq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb3huwkpqkgqeenx3bni@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb3n7w2pakgqepy6ibea@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb3nf7sqakgqeottweii@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb3puvctqkgqecwv33ca@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb3pxukpqkgqedoukyzy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb3v4wstqkgqeoe7qy3i@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb3vxuwtakgqetajiwfy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb3wzxcpqkgqecsxpktq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb56sv6qqkgqetv4rviy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb5e5ywpakgqea5klzmq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb5em4srqkgqet2whfda@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb5euroqqkgqere4boky@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb5fm2wpakgqeogckzcy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb5mkvkrakgqebidka5q@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb5nfwwpakgqeegfp7di@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb5om4wqqkgqeqke7b7a@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb67c5sqakgqejq7rowq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb6eaz6takgqeqpy4xhy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb6fcvcpqkgqe3cozi4q@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb6fjrwsakgqe4jin2ni@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb6n65sqakgqetsvs2aa@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb6ur2krqkgqexaucrjy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb6uxqoqakgqexq4wvkq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb6wh2kpqkgqe7rcsyia@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb7fsvgpqkgqedai3nxy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb7nzrwrqkgqewn3r4bq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb7v4z6rakgqewuoyrba@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb7vutwsakgqe5uynuxy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb7w3qgqakgqehgoppay@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbb7wzuorakgqeko735hy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbba4ttssakgqezqiy5ia@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbba5tyorakgqencwyynq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbba7nwopqkgqe3n4hqmy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbaei7koqkgqeifttlzy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbagg4wsqkgqe3d23ywq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbb473crqkgqefmxkkgi@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbb7672qqkgqeh3nuqmi@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbb7v62rqkgqecg3jfvq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbbma5kpakgqenytxl2i@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbbn5wkrqkgqefuofspy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbboc7wrqkgqeaqxbkva@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbbu626sakgqeopoy6ti@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbbul7ktakgqes2ayfsi@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbc4a5gpakgqeb5eyzwi@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbc4wq2pakgqeomo2o5i@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbc6gy6qakgqewzjeyqa@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbc7azsrqkgqet5ted4q@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbcghxgpakgqelgli63y@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbch4sstakgqeozyei6i@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbcm6tgrqkgqexsmsyvy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbcnevkrakgqekat74yq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbcngykqakgqe2trmpsy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbd6vrwqakgqeg4oqhbi@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbdonv6sqkgqe5p3wrnq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbdunvwsakgqelsm7gda@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbdvg5kpakgqejekg4ea@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbdwfuksakgqemn75rby@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbdwy4opakgqeymlupvy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbdxq2sqqkgqenlslqvy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbe52vksqkgqe3qbceiy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbe54uotakgqeoj5b5ma@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbe5m3oqqkgqeeijtjei@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbem4tgrqkgqei7mzc5q@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbexm2stakgqen6me76a@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbexxr2pqkgqepaa6txq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbf44uoqakgqeopumhqa@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbf5rx2rqkgqegn6i2tq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbf66xoqqkgqeq3a27ry@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbfm56kqakgqetftl3xq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbfpn42sakgqevfvjmui@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbfuc6kpqkgqehdwomni@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbfxgw6qakgqeeebigxy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbgm36kqakgqeg4d3eky@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbgot36pakgqeawdsd6a@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbgucvkrakgqewg227mi@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbh77qotakgqelxmnw2y@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbhm56sqqkgqe73lajva@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbhouvosakgqez35y5bi@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbi7q32takgqeo4cyq3a@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbieb32pqkgqextyg3ga@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbien42sakgqemfyvq5y@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbiglqwrakgqexig3d4q@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbiw3wkqakgqemnqqm4a@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbjp4skqakgqeqtrnq4i@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbju57ctakgqek6z2dhq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbjxnxwtakgqeaudhe3q@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbkfj6opqkgqev5xjsli@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbkfou2sakgqec6n4jhi@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbkgmrktakgqepp5wmrq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbkhb6coqkgqeoqcwxvq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbkvs5wtakgqevs3rm4i@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbl4iqcrakgqeylklfty@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbblej6orakgqe2ipkx2q@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbblg452takgqewex6mqq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbblog5ksqkgqeuegmoui@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbblooqwrakgqenk27jhi@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbblpo6grqkgqelo3kuwi@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbblpq2gsakgqevdnld7i@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbblpz5wrakgqerdkmriq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbn4eygsqkgqew4vsw7a@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbn4t3krakgqe5t3vnty@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbnek7gtakgqefarl5da@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbnfg7grakgqekurugkq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbnptu2qakgqe67gwmgy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbnvy3gtakgqeicsvdsa@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbo7w4spakgqeeupixia@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbooqxkpakgqe7j7m4ai@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbovctgpqkgqezagvfli@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbboxxzssakgqebcng2sy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbpe4wcpakgqenxk5jsq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbpp46woqkgqeloiel6y@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbpu4t2tqkgqejld424y@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbqgwvstqkgqevqktmwa@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbqnwtosqkgqep5ufl4a@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbqp2skqakgqehh6jovy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbqpvs2qakgqet5tphva@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbrfft2takgqe4nteltq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbrhnvoqqkgqeiwgrooi@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbroit2rakgqe26hq62q@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbrptrwpqkgqej45lx2a@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbs6v4gsakgqe4bf5dqy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbsfw3kpakgqeh3od4zi@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbsgyywsqkgqeais4faq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbsmvzgpakgqeufcvs5y@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbt4u3gpakgqersnukvy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbt62s6tqkgqegvqke7i@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbt7i6wqqkgqe52hanui@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbtohzkpakgqellpmwki@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbtvctsqakgqeeuzv3my@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbuebuspqkgqetjbzu4i@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbuesx2rakgqefq4io4y@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbuufzgpqkgqerntzmoa@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbuwfvosqkgqezosmfna@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbv43r2tqkgqejz6lcty@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbv6gqwqqkgqe6jxhiqi@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbvekqosakgqeg5ljaay@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbvhe5cpqkgqeotz3fga@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbvhhy6tqkgqexrlczei@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbvhtxoqakgqeibh6n6i@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbvmt72pakgqeql77iqi@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbvxh7srqkgqeojzmray@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbwwkxkqqkgqekx7dgma@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbxgiv2pqkgqe4wg3yba@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbxncssrakgqelvuu2gy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbby4ltgtakgqe5vti3ly@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbyehtwtqkgqeiwv4agy@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbym7rcqakgqenczhyyq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbynxz6pakgqenh474ay@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbypm2gsakgqepr5ni2q@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbywlx2pakgqevaxj2xa@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbzhgzcrqkgqe5rir2nq@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbzmbvcrqkgqefqsi37i@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbzogvwpqkgqecn3btqa@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbzvyrcpqkgqejpz34pa@americanbridge.org
ctrfriendsfamily+bncbcr43oxh6egbbzxnzwpqkgqejhnkwbq@americanbridge.org
ctrfriendsfamily+bncbdo6vsg2zmgrbduuxgpqkgqeurutcei@americanbridge.org
ctrfriendsfamily+bncbdo6vsg2zmgrbl5wyspqkgqehue3xdq@americanbridge.org
ctrfriendsfamily+bncbdo6vsg2zmgrbsek4opqkgqevpdnfci@americanbridge.org
ctrfriendsfamily+bncbdo6vsg2zmgrbzg43spqkgqepwspy6i@americanbridge.org
ctrfriendsfamily+help@americanbridge.org
ctrfriendsfamily+owners@americanbridge.org
ctrfriendsfamily+subscribe@americanbridge.org
ctrfriendsfamily@americanbridge.org
currie@bsgco.com
curtis@nti.org
cvarney@hhlaw.com
cwa@cleanwater.org
cwadhams@americanprogress.org
cwinneker@politico.eu
cxeeasslx+axkgnhq+g@mail.gmail.com
cy1pr0501mb1529bb2c1beabc09ce8f7994b5d20@cy1pr0501mb1529.namprd05.prod.outlook.com
cy1pr0501mb153113b47913d8e37a920f25b5d20@cy1pr0501mb1531.namprd05.prod.outlook.com
cy1pr0701mb111534ce3f90a3e322777dcbd9fe0@cy1pr0701mb1115.namprd07.prod.outlook.com
cy1pr0701mb111598505cb6dd22c04ab016d9fe0@cy1pr0701mb1115.namprd07.prod.outlook.com
cy1pr0701mb1584d447ea1386fcdff5b3e4d9780@cy1pr0701mb1584.namprd07.prod.outlook.com
cy1pr0701mb17850f5b2aa6050298e4f6ee938c0@cy1pr0701mb1785.namprd07.prod.outlook.com
cy1pr0801mb11611d05f3e799c5fd3f7e6dddfc0@cy1pr0801mb1161.namprd08.prod.outlook.com
cy1pr12mb0507a0324acc2ea9cbdbfaaeb2c50@cy1pr12mb0507.namprd12.prod.outlook.com
cy1pr12mb0507f2fe651d7b8745615906b2c50@cy1pr12mb0507.namprd12.prod.outlook.com
cy1pr16mb0729127d0f2bc3611a4ade8ca5d60@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb07291fbb288f839690636e40a5a60@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb07292af44a1fc1d037c67311a5ae0@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb072943de05ba60142c0aff7ca5a80@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb07294dadcd42c6947fdac4eda5ba0@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb07295c5097f3d89de19ceebda5f00@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb072965d2ac324fcb23d40dafa5af0@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb0729660d372b5d54d4282a26a5d60@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb07297d7d3e00c98c0347e8b6a5020@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb07299513f00abf9f92e3f157a5a80@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb0729a4243932697b1a080eaba5cc0@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb0729afae29b2b9f3950fb31ea5a80@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb0729b0b4bf34cd96ebd33d0ca5da0@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb0729b11d77fe993b76d6d494a5ba0@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb0729bd588ee1d257ada82feba5be0@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb0729d385667571a190a28ec1a50f0@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb0729df599c885f629d9a06d8a5be0@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb0729e3b52a17c964302278cea5d60@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb0729ea1ec84540168d6ef37da5d10@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr16mb0729ea4be861b608b7748289a50f0@cy1pr16mb0729.namprd16.prod.outlook.com
cy1pr17mb02044e1502711b81e1d6c1b7dfbe0@cy1pr17mb0204.namprd17.prod.outlook.com
czwcnyjiy7wacehphv6vop5xzou26fuvkd7o71_9ymcw@mail.gmail.com
d+unsubscribe@googlegroups.com
d.cheng@me.com
d.walker@fordfoundation.org
d00800c9d48a754da64285ea077375750126cfe3ad@clinton07.utopiasystems.net
d00800c9d48a754da64285ea07737575012a1c7a6a@clinton07.utopiasystems.net
d00800c9d48a754da64285ea0773757501312277b7@clinton07.utopiasystems.net
d00800c9d48a754da64285ea077375750132ac83e9@clinton07.utopiasystems.net
d00800c9d48a754da64285ea077375750132ad08af@clinton07.utopiasystems.net
d00800c9d48a754da64285ea077375750132ad0911@clinton07.utopiasystems.net
d02cf2eb.47925%dschwerin@hrcoffice.com
d02d6331.479e9%dschwerin@hrcoffice.com
d0337107.52f5f%ceg73@law.georgetown.edu
d035d61f.1dc69%gostin@law.georgetown.edu
d040c964d2b6864fb1b77fcdaf1852261c129f@evs1.hillaryclinton.local
d040c964d2b6864fb1b77fcdaf1852261c12df@evs1.hillaryclinton.local
d040c964d2b6864fb1b77fcdaf185226469906@evs1.hillaryclinton.local
d040c964d2b6864fb1b77fcdaf18522646990f@evs1.hillaryclinton.local
d040c964d2b6864fb1b77fcdaf185226469914@evs1.hillaryclinton.local
d040c964d2b6864fb1b77fcdaf1852264e10e6@evs1.hillaryclinton.local
d088b42b49d942b4979c348405019cd9@kslawmail.com
d0a6fe16-0714-43b1-b5b6-96dde67f998c@clintonfoundation.org
d0b5c2cf.5210d%jim@thoughtstep.net
d0e5073d-be94-4109-bdd2-925b63b1fd6d@hrcoffice.com
d0ee59b0.bc2c7%nmerrill@hrcoffice.com
d0ee664e.bc373%nmerrill@hrcoffice.com
d0eeb1aa.bcb04%nmerrill@hrcoffice.com
d0f0f4b7.30bfd%marissa.astor@icloud.com
d0f40537.c01c1%nmerrill@hrcoffice.com
d0f42650.c050b%nmerrill@hrcoffice.com
d0f4eea0.c05f3%nmerrill@hrcoffice.com
d0f90c06.113b5%jim.margolis@gmmb.com
d0f93a74.36bb2%pbrodnitz@bsgco.com
d0fa60cc.c3852%nmerrill@hrcoffice.com
d0fe543b.c3dfa%nmerrill@hrcoffice.com
d10.59e2f90f.38021070@aol.com
d100cdd6.c5199%nmerrill@hrcoffice.com
d10371e0.c661f%nmerrill@hrcoffice.com
d10f67fb.db27c%nmerrill@hrcoffice.com
d11279cb.dc727%nmerrill@hrcoffice.com
d11284fe.dc7c7%nmerrill@hrcoffice.com
d1175717.e3ba2%nmerrill@hrcoffice.com
d1189fc7.e3f2e%nmerrill@hrcoffice.com
d119dda5.e73a9%nmerrill@hrcoffice.com
d11a8c39.e794c%nmerrill@hrcoffice.com
d11a9594.e79a1%nmerrill@hrcoffice.com
d11b95e5.e87af%nmerrill@hrcoffice.com
d1247f7e.17a17%jim.margolis@gmmb.com
d129e313.fbdcf%nmerrill@hrcoffice.com
d12a4396.fc560%nmerrill@hrcoffice.com
d12b289b.fc7bd%nmerrill@hrcoffice.com
d12f8f56.103ae6%nmerrill@hrcoffice.com
d12fb9811d4c40c5bacea42d9a0c171c@nancyroteringforcongress.com
d131abd6.104a0e%nmerrill@hrcoffice.com
d131c317.104ad7%nmerrill@hrcoffice.com
d133283c.1a08e%jim.margolis@gmmb.com
d1333d87.1a13e%jim.margolis@gmmb.com
d1343485.1a1c2%jim.margolis@gmmb.com
d1343732.1a1d3%jim.margolis@gmmb.com
d135c0bf.105cbf%nmerrill@hrcoffice.com
d1372304.1068c7%nmerrill@hrcoffice.com
d13836e2.1077ff%nmerrill@hrcoffice.com
d140b44f.774ef%dschwerin@hrcoffice.com
d1419f4f.77c49%dschwerin@hrcoffice.com
d14336c0.7896e%dschwerin@hrcoffice.com
d143378d.10d425%nmerrill@hrcoffice.com
d1434e2f.10d84e%nmerrill@hrcoffice.com
d1434f46.10d887%nmerrill@hrcoffice.com
d14619b6.45352%marissa.astor@icloud.com
d146cebd.113bc2%nmerrill@hrcoffice.com
d14c735c.2334b%john@algpolling.com
d14c77d9.2338a%john@algpolling.com
d151b6b1.52700%creynolds@gpg.com
d17@clintonemail.com
d1cc38e1.3546a%john@algpolling.com
d1d4215a.319d4%jim.margolis@gmmb.com
d21668dd4bbbed9f163fb97291541940@mail.gmail.com
d233e1d6.488fb%john@algpolling.com
d24c17fc.2a8c4%gostin@law.georgetown.edu
d25110c5.16257%jim.margolis@gmmb.com
d26e2b8aff38c09c569eb900dd4bdbbb@mail.gmail.com
d2732c54.587fd%john@algpolling.com
d27340cb.1aed6%jim.margolis@gmmb.com
d292dab0.227f9%jim.margolis@gmmb.com
d2a88a1aef265b4e893e7581b6f549c60690b176@newdelhiex01.neasa.state.sbu
d2a88a1aef265b4e893e7581b6f549c62ad3a7@newdelhiex01.neasa.state.sbu
d2de5fa4.71f52%john@algpolling.com
d2e31b19-1276-435d-94a7-a7b4618b9640@xtgap4s7mta1361.xt.local
d30ac796-acfe-41b1-b681-da8ded2581f6@hsd1.co.comcast.net
d3281499-478d-46c6-a886-c351eca4bbc5@aol.com
d4c92763-bf88-4c4b-bb23-bd06ce74ec85@hrcoffice.com
d54628a055fb553866f326737530d388@bounce.bluestatedigital.com
d5570611-eae7-4613-8ea9-55e083c98669@aol.com
d5741e19e8cab942a960b129cdedeb4b078e3ca5@damon.obama.local
d5741e19e8cab942a960b129cdedeb4b078e3ca6@damon.obama.local
d5a.3284f719.3628b73d@aol.com
d5e5f922-8424-4b8c-a53f-304dbfbfad48@americanbridge.org
d5e8bd00add57141b600aa7dad7f8f190231bf67@hrm09.us.house.gov
d5gfaqd2zk-4okskn9epqnzwjkgabxdwyb+y1xdvac7w@mail.gmail.com
d64c02ce3ee32c4ea058371a2427c26c027ea8173b@clinton07.utopiasystems.net
d738a1a90808182205u5072d296y33d5939ab49ce4e9@mail.gmail.com
d738a1a90810221523h167afa05m5b7268c15879f56d@mail.gmail.com
d738a1a90810290834l518384ffs6e512d94922f15d7@mail.gmail.com
d738a1a90810290859i30046afcgd5d9cef8da4902f5@mail.gmail.com
d7c6cb6dea3f6f45b1e0bf3bd3bb440d@namprd03.prod.outlook.com
d7ee601049658a8dfc07f0ef96f5252f@mail.gmail.com
d80dcd20-f6ec-443d-97a9-9e50f1934a2a@gmail.com
d8506cac0802250909w1dbaa815nd4cff7407fb9f9ee@mail.gmail.com
d89f20d5-2bf4-4ed1-96c7-3b750c77437a@gmail.com
d8ea777f-e8f7-4673-b730-818d1631a25b@aol.com
d8x1xkrkbi-hmu2gnstxo_gj3bpj057us5jw9ngjtnsa@mail.gmail.com
d95fd7e3c26145418259f2f5e3e88e5b06152320c1@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b06152320eb@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0616cdb4db@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0616cdb921@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0616d04aa6@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0616d04aa8@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0616d04ac2@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0616d0faf3@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0616d10380@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0616d104e9@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0616d10722@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0616d349f4@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0762c5c5@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0762c5c6@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0e2ab40275@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0e2ab4031c@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0e2ab99e65@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0e2ab9a398@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0e2abc74a7@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0e2abc771c@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0e2abc7b24@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0e2abc7caf@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0e2abc7d8c@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0e309bb7b1@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b0e309bba21@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b9e3a7e15cf@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b9e3a7e1799@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b9e3a7e17a7@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b9e79cbe7ae@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b9e85e06f78@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b9e85e0713f@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b9e85e075fb@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b9e85e07950@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b9e85e07965@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b9e8fc23ed9@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b9e8fcda884@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b9ea28b3c29@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b9eb8ddb700@bryan.ad.nsnetwork.org
d95fd7e3c26145418259f2f5e3e88e5b9ec4153d5a@bryan.ad.nsnetwork.org
d9_4vhzoayyok5msgg@mail.gmail.com
d9b00076c17e6f449ad5271f9ce9ab39@namprd03.prod.outlook.com
d@db-research.com
da148fd8f4679143936b88e412ecf243@namprd07.prod.outlook.com
daca3ae9cdd46c45b1466fedcfaecdb2@namprd03.prod.outlook.com
dadbd71f3ecd1e42ad140ed28da4fd262e562b2dc9@capmailbox.americanprogresscenter.org
dah93@law.georgetown.edu
dailyskimm@morning7.theskimm.com
dailyskimm@theskimm.com
dajoi@democracyjournal.org
dal@backbonecampaign.ccsend.com
dams@hillaryclinton.com
daniel.esty@yale.edu
daniel.jester@gmmb.com
daniel_hornung@omb.eop.gov
daniellagibbsleger@gmail.com
danielle.rhoades-ha@nytimes.com
danielle@pogo.org
danielsilverberg@yahoo.com
dankalik@jstreetpac.org
darwarner@gmail.com
dave@fooddemocracynow.org
david.a.donnelly@gmail.com
david.willett@sierraclub.org
david@db-research.co
david@db-research.com
david@dixondavismedia.com
david@huffingtonpost.com
david_sandretti@lcv.org
davidbrock@gmail.com
davidbrockdc@gmail.com
davidjhayes01@gmail.com
davidwittie@yahoo.com
db9db4c5a454ee48ba262917a04ede7c@namprd03.prod.outlook.com
dbaafead6699634d8381c944fdfe8c0f327a6ef9@evs1.gqrr.local
dbenjam61@hotmail.com
dc51ca130b02c546a982679cdf0ccbef028beeb7@evs1.gqrr.local
dc51ca130b02c546a982679cdf0ccbef032fb482@evs1.gqrr.local
dce92b10-e19d-4c12-b550-34bac0b25103@gmail.com
dcfde056-7a44-467e-b00f-ce1e0597bff7@gmmb.com
dcgordon@stanford.edu
dcheng@clintonfoundation.org
dcheng@hillaryclinton.com
dchoyas@dchoyas.org
dcorps@democracycorps.com
dctrooper@gmail.com
ddonnelly@campaignmoney.org
de5ba76051b9ae4d83943afdbc9c443a@namprd03.prod.outlook.com
de606e1c8a5fd5031edcfc6f1b954cd9@mail.gmail.com
deb@brand-sphere.com
debbie.masterson@tedturner.com
deborah.doctor@disabilityrightsca.org
deborah@cltcec.org
delivery@mx.sailthru.com
demastrie@gmmb.com
democracycorps.com@mail210.atl21.rsgsv.net
den@gmail.com
den@hillaryclinton.com
denis.mcdonough@gmail.com
dennis@hillaryclinton.com
der@amyskitchen.net
derek.webb@law.stanford.edu
des@morganstanley.com
desta@gmail.com
devinemulvey.com@mail182.wdc02.mcdlv.net
df001503bd167f392ba07f190a09a483@bounce.bluestatedigital.com
df21ab6f9cc6834d9cfd91195ce43f21@bounce.bluestatedigital.com
df4d5c85-a198-41b5-9438-385f5ba23541@aol.com
dfb05zn7n0xjpbvtfm9olm+eg0wt2_yg8r+agzkkzp5q@mail.gmail.com
dfc0aea27a8bc2449900ec226fa8c82e@namprd03.prod.outlook.com
dggaxtzipnuw2623ghs5u_bv8z2t9a4qczpyhww@mail.gmail.com
dgxexhmfekymufs8bfmcvgynuledbvrqvqxwvj9ewgaafkjuiwghq0tuvvpdalyvde5ehfftedpxdqi@bounce.bluestatedigital.com
dhalperin@ipforum.org
dhayes@law.stanford.edu
dhc2wtbsishacwzmrjppdhhaupsjjxzk61bbvjhg@mail.gmail.com
dhchollet@gmail.com
diana@chelseaoffice.com
diehlj@washpost.com
digicha@gmail.com
dillon@clifbar.com
dina.b.mishra@gmail.com
disilvio@gmail.com
djsberg@gmail.com
djt152q4zyr_f-a4hofmzq@mail.gmail.com
dkendall@wc.com
dkurtzphelan@gmail.com
dlairy@hotmail.com
dleger@americanprogressaction.org
dlockett@gqrr.com
dm2pr0301mb073509f2d9d24fee85ec5ed6b7f20@dm2pr0301mb0735.namprd03.prod.outlook.com
dm2pr0301mb0736e0196e81d5d3924bde71b7f20@dm2pr0301mb0736.namprd03.prod.outlook.com
dm2pr0501mb15185857fa6d58445edb7de5abd20@dm2pr0501mb1518.namprd05.prod.outlook.com
dm2pr0501mb1566142e7932277bb50d2bafdebf0@dm2pr0501mb1566.namprd05.prod.outlook.com
dm2pr0501mb15661efff1b9cae2379f5bb1debf0@dm2pr0501mb1566.namprd05.prod.outlook.com
dm2pr05mb70211bf9a8a4e462a6b24df86d20@dm2pr05mb702.namprd05.prod.outlook.com
dm2pr05mb73311ec5aa39df05a9388fbf6cc0@dm2pr05mb733.namprd05.prod.outlook.com
dm2pr0601mb713a6fa8b723c72737457fb833c0@dm2pr0601mb713.namprd06.prod.outlook.com
dm2pr0701mb1119102296e9402bec4317edd9490@dm2pr0701mb1119.namprd07.prod.outlook.com
dm2pr07mb367671ed72dbe39a002d5f993bc0@dm2pr07mb367.namprd07.prod.outlook.com
dm2pr07mb495ae2dfc7a50ab453d2dda93590@dm2pr07mb495.namprd07.prod.outlook.com
dm2pr07mb495c84b95b9a034a55af2e393a20@dm2pr07mb495.namprd07.prod.outlook.com
dm2pr07mb5416e63bad5a9f1cea54b47930c0@dm2pr07mb541.namprd07.prod.outlook.com
dm2pr07mb541918a3f1cd66a1e77b6e593090@dm2pr07mb541.namprd07.prod.outlook.com
dm2pr07mb541ff8f6175c9dbad9899da93370@dm2pr07mb541.namprd07.prod.outlook.com
dm2pr07mb54245745ad3602a8399952893da0@dm2pr07mb542.namprd07.prod.outlook.com
dm2pr07mb54288d7e71cdc037f37aeff93e70@dm2pr07mb542.namprd07.prod.outlook.com
dm2pr07mb5429894437eeb010564ac6893220@dm2pr07mb542.namprd07.prod.outlook.com
dm2pr07mb542b05b97e534c419e8b51793a10@dm2pr07mb542.namprd07.prod.outlook.com
dm2pr07mb54324daf7e5507ca108c97d93c40@dm2pr07mb543.namprd07.prod.outlook.com
dm2pr07mb543348d53560f7095117a2f93220@dm2pr07mb543.namprd07.prod.outlook.com
dm2pr07mb543516c9e573f80d1282d1e932b0@dm2pr07mb543.namprd07.prod.outlook.com
dm2pr07mb54378cb6b05f4c5a58f6c63931c0@dm2pr07mb543.namprd07.prod.outlook.com
dm2pr07mb543d8202a98fbb97b50fd5c932c0@dm2pr07mb543.namprd07.prod.outlook.com
dm2pr07mb5440d88bc805541f20582b893a90@dm2pr07mb544.namprd07.prod.outlook.com
dm2pr07mb5441a660db241cc4d02132c931d0@dm2pr07mb544.namprd07.prod.outlook.com
dm2pr07mb5442aad6ea997c574838fdf93120@dm2pr07mb544.namprd07.prod.outlook.com
dm2pr07mb5444fb51271167c36363167931a0@dm2pr07mb544.namprd07.prod.outlook.com
dm2pr07mb54476fd1d9c0a33a7e793c8934b0@dm2pr07mb544.namprd07.prod.outlook.com
dm2pr07mb544b3f0c51a090770f9b91f93d50@dm2pr07mb544.namprd07.prod.outlook.com
dm2pr07mb544d31d1660f35902f6e51a93480@dm2pr07mb544.namprd07.prod.outlook.com
dm2pr07mb544d37142cb53ecef5e4176933d0@dm2pr07mb544.namprd07.prod.outlook.com
dm2pr07mb544ea577e4cfd1cbaebfddd93140@dm2pr07mb544.namprd07.prod.outlook.com
dm2pr07mb559751ca13162b73001ce2193e60@dm2pr07mb559.namprd07.prod.outlook.com
dm2pr07mb5607c8f3cb61ef017fcf9a693310@dm2pr07mb560.namprd07.prod.outlook.com
dm2pr08mb44503c380db9da0507ec422bf730@dm2pr08mb445.namprd08.prod.outlook.com
dm2pr08mb4450f34fa14532dc50402dbbf8a0@dm2pr08mb445.namprd08.prod.outlook.com
dm2pr08mb445da576ca627999ae212fcbf3d0@dm2pr08mb445.namprd08.prod.outlook.com
dm2pr08mb4462a05886f2cccdb7db067bf100@dm2pr08mb446.namprd08.prod.outlook.com
dm2pr08mb44659d08287513f071bd5b6bfcd0@dm2pr08mb446.namprd08.prod.outlook.com
dm2pr08mb4466351b5701efa977f355cbf7d0@dm2pr08mb446.namprd08.prod.outlook.com
dm2pr08mb44681b7538448cc6ae8ffe7bf200@dm2pr08mb446.namprd08.prod.outlook.com
dm2pr08mb446919671900d9836533455bf980@dm2pr08mb446.namprd08.prod.outlook.com
dm2pr08mb4474de1a9aabe78a775f772bfe50@dm2pr08mb447.namprd08.prod.outlook.com
dm2pr08mb447b5a1cc349bd8fb22beffbf200@dm2pr08mb447.namprd08.prod.outlook.com
dm2pr08mb447c58d9a87a287e1a97c68bfa90@dm2pr08mb447.namprd08.prod.outlook.com
dm2pr08mb447d2d4004787c48efadcd9bf6e0@dm2pr08mb447.namprd08.prod.outlook.com
dm2pr08mb448056b114117076be5ae2dbf730@dm2pr08mb448.namprd08.prod.outlook.com
dm2pr08mb4481543fae1181ab17ed37dbf8a0@dm2pr08mb448.namprd08.prod.outlook.com
dm2pr08mb4481d18c4cda2c3378d9380bf100@dm2pr08mb448.namprd08.prod.outlook.com
dm2pr08mb448204a4b28b52e90e5e174bfcd0@dm2pr08mb448.namprd08.prod.outlook.com
dm2pr08mb44853c94ced1ce36b931fd5bfe50@dm2pr08mb448.namprd08.prod.outlook.com
dm2pr08mb448739d455aa600ce00dabfbfa90@dm2pr08mb448.namprd08.prod.outlook.com
dm2pr08mb448a8c7801a3834ec90f364bfd20@dm2pr08mb448.namprd08.prod.outlook.com
dm2pr08mb448ac98b292399d61aebda1bf980@dm2pr08mb448.namprd08.prod.outlook.com
dm2pr08mb448ca0450527d75973ed22fbf200@dm2pr08mb448.namprd08.prod.outlook.com
dm2pr08mb448df382ed64b928f3cb9afbfd20@dm2pr08mb448.namprd08.prod.outlook.com
dm2pr08mb448e3272c62b2a419d1c781bf200@dm2pr08mb448.namprd08.prod.outlook.com
dm2pr08mb448f37b1343e41b723903d1bf3d0@dm2pr08mb448.namprd08.prod.outlook.com
dm2pr08mb448f3996c6b65e0c1f0cf2dbf7d0@dm2pr08mb448.namprd08.prod.outlook.com
dm2pr08mb448fe0cbfbbfb8573799541bf6e0@dm2pr08mb448.namprd08.prod.outlook.com
dm__150331173008_43778148361@smtp.lces-lowcarboncity.com
dmarin@podestagroup.com
dmcdonough@barackobama.com
dmercer@mercerassociates.com
dmiller@campaignmoney.org
dncpress@dnc.org
dniqnn-ahkptqqemingbhpgpsdhq7pmy2rna@mail.gmail.com
dnmv7yubpl9pqta25xw@mail.gmail.com
don.gips@gmail.com
don.gips@level3.com
don.smalter@gmail.com
donbaer@ps-b.com
donkerrick@comcast.net
donkerrick@gmail.com
donna@sfihsspa.org
donotreply@gmfus.org
dorr@oberlin.edu
doug@presidentclinton.com
dperls@foe.org
dpeter3@entergy.com
dpfeiffer@barackobama.com
drive-shares-noreply@google.com
drleepolls@cox.net
ds@hillaryclinton.com
dschwerin.hrco@gmail.com
dschwerin@hillaryclinton.co
dschwerin@hillaryclinton.com
dschwerin@hrcoffice.co
dschwerin@hrcoffice.com
dskurka@clintonfoundation.org
dstabenow@stabenowforsenate.com
dstewart@jamsadr.com
dswzlcgh+va2mqy98ffmc1w8wpedccusxwv6fxkofvwq@mail.gmail.com
dt@hillaryclinton.com
dub127-w129ea3af26b2e2f70811df828f0@phx.gbl
dubois.sara@gmail.com
dwfzqaqib0cwoguccfxvwfbyvfemalekuf07cvlcw0ovcljqebahdajeuvxds1aodg@bounce.bluestatedigital.com
dwfzqaqib0cwogucv1nvbaanvledavvwuwk7cvlcw0ovcljqebahdajeuvxds1aodg@bounce.bluestatedigital.com
dwfzqaqib0cwogumageabaiobaucblnquw07cvlcw0ovcljqebahdajeuvxds1aodg@bounce.bluestatedigital.com
dwfzqaqib0cwogumalikv1apagidaqdqbgw7cvlcw0ovcljqebahdajeuvxds1aodg@bounce.bluestatedigital.com
dwv1pupre9b9htkq@mail.gmail.com
dy.goff@gmail.com
e.sullivan@gmail.com
e00adeee-54bf-4231-8909-6508522add8f@gmail.com
e011128f-ba4c-4759-a737-7ea2fb8bc72b@gmail.com
e138f1c003434d829e21a7f7c44c8cb5@co1pr07mb313.namprd07.prod.outlook.com
e14d5fde08e02d4bbda429f9e1acb86f07ecd5@s2376m11.cdsmail.pvt
e1648fe4f93138e3738f9ecbdef11cf4@mail.gmail.com
e1d83270-b38a-470c-8a63-4375caf74352@gmail.com
e32604bc-9886-4316-ab38-27957ce28b98@gmail.com
e343549867be63a94a60836d3b348951@mail.gmail.com
e3b2d4590808270720h251a2b06n6652991d72a27f4@mail.gmail.com
e3b2d4590808280725ge727dfbr7a0bbabc06ae02e3@mail.gmail.com
e3b2d4590810010422h1cd4c09y8d39a73b12979ead@mail.gmail.com
e3b2d4590810020452h5040ebdfk8b6b4328cd782274@mail.gmail.com
e3b2d4590810080456r75f3cbc4j86a8ac57a1ae8709@mail.gmail.com
e3b2d4590810130432h642efa84y36b6057bda552bc1@mail.gmail.com
e3b2d4590810220432v1e04ee6bjba165a21b7037cf4@mail.gmail.com
e3b2d4590810300442sfa13ct498c342adefd92dc@mail.gmail.com
e41197a167bdbe2b7484f51f0fafa1e0@mail.gmail.com
e47@hillaryclinton.com
e514ceb5-f87f-402a-8453-53b339784207@aol.com
e61ab98d-8bde-4095-9960-16f32153df8d@progressivemediausa.org
e622b387aa9638289b575138c8016391@mail.gmail.com
e623334246ec692ace1ea41f18cb5c9e@bounce.bluestatedigital.com
e6339af8f436cb4b9d6a2bf234badce98f6085@tenexccs1.tenalps.local
e6b7b26fcb4605d27a47730ece42a723@mail.gmail.com
e6c03610-3d44-41ce-a63e-a9c208a262a9@gmmb.com
e7pus+j7htfdm8j74h7dik57axqqrbpjoj8hg@mail.gmail.com
e803ca81d52a10ec5a80a03744328208@mail.gmail.com
e80cec0e-d069-414b-85b5-eb6b91be5982@aol.com
e8679e2243298a4e9ddeaadb28d063f6b467a502@ctcxmbx11.ap.org
e8679e2243298a4e9ddeaadb28d063f6b467a5b0@ctcxmbx11.ap.org
e86a1d5e0911121201h3f60ae3eo4c05719284ecd7cd@mail.gmail.com
e89a8ff1cf02f574dd05187fdaa1@google.com
e93f40e84e40a3f381ba06cd92138783@bounce.bluestatedigital.com
e95d0bd80807290843x6ae48e8aicb0161abb6bd06ce@mail.gmail.com
e9unwzzhk5roqpgjmzpf+xbryfafpf8nya_yhf+2sg@mail.gmail.com
e@genius-network.com
e@gmail.com
e@gmmb.com
e@verizon.net
eackel@lafla.org
eaden@hillaryclinton.com
eam607f9pt7yjfgnui7in7cn.1453593832337@email.android.com
eamonn@helprefugees.org.uk
eannunziata@cleanwater.org
earthpolicynews@earth-policy.org
eb-ca483eafb141@hrcoffice.com
eb0362ea1003231434pe2ccf6cnb7e9be2cb7183d31@mail.gmail.com
ebb702a9-5ed4-43c1-8a47-d6a2418ca61a@gmail.com
ebrolin@me.com
ebrw@mail.gmail.com
ec6495db-d48c-413f-aadf-cbfcf6fa473b@alumni.stanford.edu
ec8eyo5c74qemfkt-4dwjhccang@mail.gmail.com
ecastano@aol.com
ector@centerforfoodsafety.org
ed.hughes@clintonglobalinitiative.org
edb26452-4c18-444b-be15-98ce3afeb5ac@gmail.com
edc063b5-9a69-4524-80f6-9bc605611ce9@perkinscoie.com
eddie.vale@gmail.com
eddie@progressiveaccountability.org
eddy.goff@gmail.com
editor@iowadailydemocrat.com
editor@truthout.org
editors@washingtonmonthly.com
edley@law.berkeley.edu
edu@mail.americanbar.org
ee4d24620905220926l48b2c2e6vce04a57af6f2d02c@mail.gmail.com
ee51160d-0e8e-4940-b55b-f2a64c3b2422@gmail.com
ee67d7720805220834q216845c2n82798f207aa46963@mail.gmail.com
ee@albrightstonebridge.com
eee6dd096e444ade67e0bc1b1067f6c5@mail.gmail.com
ef246@law.georgetown.edu
ef4b47224a729cbb02177c9b600467f9d3e.20160128182930@mail25.suw17.mcsv.net
ef4b47224a729cbb02177c9b600467f9d3e.20160208185928@mail152.suw16.rsgsv.net
ef6e34055031f54b8f14692785c4499c@namprd03.prod.outlook.com
efarkas@aol.co
efarkas@aol.com
efec78e70806030949i292b69c7g3fd70feac1619f8b@mail.gmail.com
efec78e70806030951y210cb6e4m4f6947965127d1d@mail.gmail.com
efec78e70806101953v7b21b7beg2c3378bfcc678942@mail.gmail.com
efec78e70806101957u17942357wac25306cf608237@mail.gmail.com
efec78e70806111902l11c50c1dhd5af2606012755fd@mail.gmail.com
efec78e70806111905i2fbf4a34uf7be3f51d4f49369@mail.gmail.com
efec78e70806160827m45e77263h24ca42080b4f5b5f@mail.gmail.com
efec78e70806160828n9ea148fi7856620fef8b0e22@mail.gmail.com
efec78e70806191929q377050ccm4eddd123cd603327@mail.gmail.com
efec78e70806221314w799bab3v1fa1685e1e52dd70@mail.gmail.com
efec78e70806221317j492aadb3u8d8fb42bbc0eeae4@mail.gmail.com
efec78e70806232015u6adf18e4obbca1bdb7858d4e1@mail.gmail.com
efec78e70806232018p11943a00g579f51dffefdc91@mail.gmail.com
efec78e70806242001w79b904bes2f1211158fcd2249@mail.gmail.com
efec78e70806242007j3c2e54b1l6dad248173a52e9f@mail.gmail.com
efec78e70806251845nb0299ffp99fb6ddd1f9dbab4@mail.gmail.com
efec78e70806251848q4df08258g7146457c7dc296d8@mail.gmail.com
efeder@clintonfoundation.org
effort@manatos.com
efrances384@yourdre.info
egelber.hrco@gmail.com
egelber@hrcoffice.com
egramling@hillaryclinton.com
egudmundson@hillaryclinton.com
ehananoki@mediamatters.org
eileen.murphy@nytimes.com
ein@hillaryclinton.com
einbaugh@pmidpi.com
eizenstat@cov.com
ejacobs@equitablegrowth.org
ejjudmbqyndnzhc+q-glea@mail.gmail.com
ek-zsnzgfmljjpuafs0w4xamx6chn4rckw@mail.gmail.com
ekriegel@hillaryclinton.co
ekriegel@hillaryclinton.com
ekvygdqk_tgwz0utg@mail.gmail.com
el@gmmb.com
elconsult@hotmail.com
eld@brand-sphere.com
elgarsubscribe@e-elgar.com
elgarunsubscribe@e-elgar.com
elgieh@yahoo.com
elgiehn@yahoo.com
elight65@gmail.com
ellen.esterhay@gmmb.co
ellen.esterhay@gmmb.com
elson@cdmillsgroup.com
elson@gmail.com
email@e.washingtonpost.com
email@mail.nbcnews.com
email@politicoemail.com
email_feedback_handler@mta-inbound.cluster3.convio.net
emastrie@gmmb.com
emily@flextimeglobal.com
emily_d_blakemore@who.eop.gov
emre.peker@wsj.com
en.esterhay@gmmb.com
en.sack@oceanunite.org
en@aol.com
en@consumer.org
enenson@bsgco.com
eng@ricehadleygates.com
ennifer.m.palmieri@gmail.com
enson@bsgco.com
enstat@cov.com
epg@mail.gmail.com
ephens@naturespath.com
er.brent@ymail.com
er.miller@benjerry.com
er@amyskitchen.net
er@asc.upenn.edu
er@fwwatch.org
er@hillaryclinton.com
er@hks.harvard.edu
erdahl@hillaryclinton.com
erenda@hillaryclinton.com
erger@hillaryclinton.com
erguson@hillaryclinton.com
eri@gmail.com
eri@hillaryclinton.com
eric@schmeltzerpr.com
eric@votevets.org
eric_h_schultz@who.eop.gov
ericgarcetti.com@nationbuilder.com
ericv312001@sbcglobal.net
erin@gmail.com
erin@hillaryclinton.com
erin@hrcoffice.com
erner.tikkun@gmail.com
erome@afscme.org
errill@hrcoffice.com
errol.schweizer@wholefoods.com
erschlag@foe.org
erskine@2bowles.com
erts@albrightstonebridge.com
eruiz@hillaryclinton.com
eryl.mills@gmail.com
eryn.sepp@gmail.com
eryn_m_sepp@who.eop.gov
esc1104437006133_1102246000775_8585_r20@in.constantcontact.com
esc1114813973856_1101360615949_43405_r20@in.constantcontact.com
esc1115452317206_1101360615949_43405_r20@in.constantcontact.com
esepp@americanjprogress.org
esepp@americanprogress.org
esepp@equitablegrowth.org
esepp@hillaryclinton.com
esepp@who.eop.gov
ess@hillaryclinton.com
esse@jesseferguson.com
esta@gmail.com
esta@podesta.com
esterhay@gmmb.com
et@gmail.com
etereas@gmail.com
etimmons@equitablegrowth.org
etqghpnmlohvoysgftggo8by9doscf3q@mail.gmail.com
etters@nytimes.com
etvw@mail.gmail.com
etwork@googlegroups.com
european.studies@wilsoncenter.org
europeprogram@gmfus.org
eutrup@barackobama.com
evale@progressivemediausa.org
evan.zoldan@utoledo.edu
evan@progressiveaccountability.org
events@americansecurityproject.org
events@hudson.org
ew3veesdpb3scshqc-lqjg@mail.gmail.com
ewhitbeck@progressivemediausa.org
ewhulofczda5cpcsm5ppw+b4a-s_2yqavw5fca@mail.gmail.com
ewpcububekdsbgyhuwchwqvyawecvanvvzbydf5agxqkavngfwumuwhswvkfblwmag4gba@bounce.bluestatedigital.com
ewpcububekdsbqcbcfxvuvqlcqnsalqlwjbydf5agxqkavngfwumuwhswvkfblwmagogag@bounce.bluestatedigital.com
ewpcububekdsbqkbafxruayibfafuvjsatbydf5agxqkavngfwumuwhswvkfblwmagebbg@bounce.bluestatedigital.com
ewpcububekdsbqkccvmebvekbgccavukvtbydf5agxqkavngfwumuwhswvkfblwmagedba@bounce.bluestatedigital.com
ewpcububekdsbqkfvvdwvquau1yeulilvdbydf5agxqkavngfwumuwhswvkfblwmag4jbg@bounce.bluestatedigital.com
ewpcububekdsbqknbvxwwfbdvazwbwygadbydf5agxqkavngfwumuwhswvkfblwmagebbq@bounce.bluestatedigital.com
ewpcububekdsbqlqafmdaloauqzqaqrwuzbydf5agxqkavngfwumuwhswvkfblwmagedaw@bounce.bluestatedigital.com
ewpcububekdsbqlqawmgbvskagnwulebvdbydf5agxqkavngfwumuwhswvkfblwmageaaw@bounce.bluestatedigital.com
ewpcububekdsbqlqulmdwveiawjvalbvwzbydf5agxqkavngfwumuwhswvkfblwmageaba@bounce.bluestatedigital.com
ewpcububekdsbqlqvwcluajbafnruvbxwjbydf5agxqkavngfwumuwhswvkfblwmagecbg@bounce.bluestatedigital.com
ewpcububekdsbqlubgbwvfcpvledagaeutbydf5agxqkavngfwumuwhswvkfblwmagajba@bounce.bluestatedigital.com
ewpcububekdsbqlwagdragckb1cgblicvjbydf5agxqkavngfwumuwhswvkfblwmagagbq@bounce.bluestatedigital.com
ewpcububekdsbqlwbvxwvloluqahvlacatbydf5agxqkavngfwumuwhswvkfblwmagahaq@bounce.bluestatedigital.com
ewpcububekdsbqlwu1bwbwibbvefblwguzbydf5agxqkavngfwumuwhswvkfblwmagahbg@bounce.bluestatedigital.com
ewpcububekdsbqlxagmebwvcbvmabaycadbydf5agxqkavngfwumuwhswvkfblwmag4jaa@bounce.bluestatedigital.com
ewpcububekdsbqlxblqawqapaqamvvmeadbydf5agxqkavngfwumuwhswvkfblwmag4jcw@bounce.bluestatedigital.com
ews@thehill.com
ewuser@asc.upenn.edu
exander@clintonfoundation.org
executiveintern@gmfus.org
externalrelations@csis.org
exvvjcxye0w-auxif5s5m-m2i+ztw@mail.gmail.com
exyng0bw@mail.gmail.com
ey@hillaryclinton.com
eyekutiel@hillaryclinton.com
eyjtwby_0htusnhgwb26pyd_mw-ljzjdstzvp2bvspw@mail.gmail.com
eyld2bmfc1dco0xecdyt1nqw@mail.gmail.com
eynolds@gpg.com
eynolds@hillaryclinton.com
eztfqt+3krjh800m5ez7-gsypv2g@mail.gmail.com
f09c00c0-d5cd-4ca5-bc80-541b6b9bef9f@gmail.com
f108822cb3dea445af4a1d83c21c79cb01562b44@mars.foe.local
f108822cb3dea445af4a1d83c21c79cb01562b7a@mars.foe.local
f108822cb3dea445af4a1d83c21c79cb01562d0e@mars.foe.local
f108822cb3dea445af4a1d83c21c79cb01562d0f@mars.foe.local
f1966c1cbf734741b330a2d1c3e304ce@co1pr07mb313.namprd07.prod.outlook.com
f1d8eec4d727e61e84399b93c35932c5@mail.gmail.com
f1f5620cd242c041448749b9825256dc@bounce.bluestatedigital.com
f24fa335c3c7fa48a4d717abb7f2809d@namprd03.prod.outlook.com
f268b2f26e0ca5824aff057e5875ab38019.20150911231736@mail182.atl101.mcdlv.net
f268b2f26e0ca5824aff057e5875ab38019.20150918221151@mail46.atl11.rsgsv.net
f268b2f26e0ca5824aff057e5875ab38019.20150925224541@mail151.atl171.mcdlv.net
f268b2f26e0ca5824aff057e5875ab38019.20151009225749@mail40.atl111.rsgsv.net
f268b2f26e0ca5824aff057e5875ab38019.20151016231856@mail56.atl51.rsgsv.net
f268b2f26e0ca5824aff057e5875ab38019.20151023224116@mail170.atl171.mcdlv.net
f268b2f26e0ca5824aff057e5875ab38019.20151030230143@mail39.atl71.mcdlv.net
f268b2f26e0ca5824aff057e5875ab38019.20151107002551@mail211.suw14.mcdlv.net
f268b2f26e0ca5824aff057e5875ab38019.20151113233533@mail39.atl31.mcdlv.net
f268b2f26e0ca5824aff057e5875ab38019.20151120232650@mail141.wdc01.mcdlv.net
f268b2f26e0ca5824aff057e5875ab38019.20151125231535@mail187.atl101.mcdlv.net
f268b2f26e0ca5824aff057e5875ab38019.20151204231323@mail171.wdc02.mcdlv.net
f268b2f26e0ca5824aff057e5875ab38019.20151207201941@mail72.suw15.mcsv.net
f268b2f26e0ca5824aff057e5875ab38019.20151218233612@mail23.us4.mcsv.net
f268b2f26e0ca5824aff057e5875ab38019.20151224222628@mail215.atl61.mcsv.net
f268b2f26e0ca5824aff057e5875ab38019.20160109001346@mail44.atl111.rsgsv.net
f268b2f26e0ca5824aff057e5875ab38019.20160115235529@mail199.atl101.mcdlv.net
f268b2f26e0ca5824aff057e5875ab38019.20160123001601@mail40.atl111.rsgsv.net
f268b2f26e0ca5824aff057e5875ab38019.20160126180808@mail8.atl31.mcdlv.net
f268b2f26e0ca5824aff057e5875ab38019.20160129231930@mail55.atl111.rsgsv.net
f268b2f26e0ca5824aff057e5875ab38019.20160206003829@mail168.atl101.mcdlv.net
f268b2f26e0ca5824aff057e5875ab38019.20160212235551@mail34.atl91.mcsv.net
f268b2f26e0ca5824aff057e5875ab38019.20160220010730@mail6.us4.mcsv.net
f268b2f26e0ca5824aff057e5875ab38019.20160227010440@mail22.us4.mcsv.net
f2851ea733bf2044bb1050d41f9241b6@namprd03.prod.outlook.com
f2c05993-d6b9-40b2-9b13-29a9f9fb6b81@yale.edu
f2f5fbb8408f42c6ae4d8c2470d1a8c7@stabenowforsenate.com
f35518099a7ca54d8702eea798eca774@exchange.mit.edu
f38023b3-78a3-48c0-9f7f-c9403ac27609@gmail.com
f39gwfftlk5rldlilwnw@mail.gmail.com
f3d3fd27bd777757fa518a21956ea256efc.20130613152550@mail182.wdc02.mcdlv.net
f3edfe411d5745d903b1e9017431d448@bounce.bluestatedigital.com
f43fbb3c-dbca-47a6-a98e-572de384446b@americanbridge.org
f4e1ccd0cd6da8be92b069abff42419b@mail.gmail.com
f545ee98d60ff1076df5ca3e38d8ee6a@mail.gmail.com
f652fd7157f3814886d064763c7eadd8160f89bf@rev02exch01.revolution.ad
f69a5b9d-7289-4725-8933-33b8dcb8e9c2@aol.com
f6mp39dxmdcrmkqhdzqorvuostauhdb+q@mail.gmail.com
f7oetm3ghx2a47ks7hugrvcnr9d_ffnw-q@mail.gmail.com
f84a8eef00181c4c84ad2fc4d41ee1c214b3d96a8f@clinton07.utopiasystems.net
f84a8eef00181c4c84ad2fc4d41ee1c214b3d98673@clinton07.utopiasystems.net
f86167f0-6672-44b6-aba4-546865b746c7@minassianmedia.com
f8fb37050806170940u1b5ca40csc9c2e22d866f79ee@mail.gmail.com
f8fb37050806230850k3fb45775p1d39971e8f223050@mail.gmail.com
f8fb37050806230853o3f1f694fm61f9a55ab5ea4f71@mail.gmail.com
f9db78f1-1607-4bc5-8f2b-ae2ac099b15d@algpolling.com
f@hillaryclinton.com
fa0b6cf80807071304r7127e8c2i325da975acd94e04@mail.gmail.com
fa0b6cf80807081015o10c9da9em1a2e90d30d0797d6@mail.gmail.com
fa0b6cf80807091413i5d668351od476c5b995fd62fb@mail.gmail.com
fa0b6cf80807101036p650b97b1j96b01f836b791667@mail.gmail.com
fa0b6cf80807111051o161cd8ddkc60088e0cdd8ef4c@mail.gmail.com
fa0b6cf80807111333i728fe618gf01f568fc4b33ee1@mail.gmail.com
fa0b6cf80807111427s34b7bb94s72888bbcefb6410@mail.gmail.com
fa0b6cf80807151515v7c6692ev5e6ce85ac3c886a9@mail.gmail.com
fa0b6cf80807160949g6fba646fvd3f9b2239ba4b1ad@mail.gmail.com
fa0b6cf80807191228x14083f45wa5bc4b94ecd9c1df@mail.gmail.com
fa0b6cf80807191234x512b8f05oc4c1d10c8793a049@mail.gmail.com
fa86853f-a9a9-414c-bfaf-c42ce09569db@gmail.com
faa7619b14567c843ee0d1f5fd6d396e@bounce.bluestatedigital.com
facj4phhj4yyu2qln5xp+ac3l_mjwdo1yya@mail.gmail.com
facstaff_dist@knox.edu
facultysupport@law.georgetown.edu
fafcuag0caaqg@bounce.bluestatedigital.com
fafcuag0cawep@bounce.bluestatedigital.com
fafcuag0cbwap@bounce.bluestatedigital.com
fafcuag0cbwyc@bounce.bluestatedigital.com
fafcuagoaaacd@bounce.bluestatedigital.com
fafcuagobaamo@bounce.bluestatedigital.com
fafcuagofcgif@bounce.bluestatedigital.com
fafcuagogagup@bounce.bluestatedigital.com
fallon@hillaryclinton.com
fanny.l.sliwinski@chase.com
fb28a5bc-6b98-4eb6-9008-8ce11c36987f@sandlerfoundation.org
fbx5cusaciybg@mail.gmail.com
fc11fe6c560a272ed91c3e9f7d2c5839@mail.gmail.com
fc2dbdb7ca7342799d043623b83fd79e@co1pr07mb313.namprd07.prod.outlook.com
fd9c3e6e228854fdc8fcbd516e14ade1@mail.gmail.com
fdf73da1-cf36-4187-a5a8-fc6696e6fb44@aol.com
fe5a9b8fcf3b3f41ae95fb23b4f01b9d@exchange.mit.edu
federica.mogherini@ec.europa.eu
fedplayers@ourpublicservice.org
feedback@lcv.org
fer.m.palmieri@gmail.com
fer@americanprogress.org
ferdahl@hillaryclinton.com
ff113ead-3199-41a0-929c-d2f6c50063b7@gmail.com
ff844f1396883b47cd442e9f78cc2375@mail.gmail.com
ffc56f860806060900r4002e157t6765d53f40e1be54@mail.gmail.com
ffc56f860806111001n7cf57495q3457bd71b02da985@mail.gmail.com
ffd2869897a61e4290219321f30c9026@namprd03.prod.outlook.com
fferdahl@hillaryclinton.com
fffb3788-c4a8-4ed1-bbbc-3a7f4b42783d@gmail.com
fgx2oncmhjmuyiqtg5_oa@mail.gmail.com
finneyk8@yahoo.com
firstdraft@nytimes.co
firstdraft@nytimes.com
fisher@hillaryclinton.com
fkempe@acus.org
flacacata@aol.com
flagov@myflorida.com
fo2ch96ceju0a3jbz4ep8evgbx7psjisg@mail.gmail.com
forwardthis@barackobama.com
foster.brent@ymail.com
fpena@vestarden.com
fpintern2@gmfus.org
fpintern@gmfus.org
fqqljsbcft4xkqzdwhba@mail.gmail.com
fqtxvhcncvpsvqccb1qcalmluqiabgahaw@bounce.bluestatedigital.com
fqtxvhcncvpsvqhwvazvwfqiagqcvlvraa@bounce.bluestatedigital.com
frankl03@yahoo.com
fred.hiatt@washpost.com
friends-of-afghanistan-network+unsubscribe@googlegroups.com
friends-of-afghanistan-network@googlegroups.com
fromanm@citi.com
fromanm@citigroup.com
fshakir@americanprogress.org
fta@gmail.com
funk@americansunitedforchange.org
fwilliams@buffnews.com
fwkq@mail.gmail.com
fyassaee@albrightstonebridge.com
fyugggp9fzawosuqayvu+oqg@mail.gmail.com
g-msnfqiku95gckp1g@mail.gmail.com
g@mail.gmail.com
ga3we4+w@mail.gmail.com
garunsubscribe@e-elgar.com
gary.hart@ucdenver.edu
gary@usrtk.org
gawrykt@att.net
gaylesmithgayle@gmail.com
gcampaign@googlegroups.com
gcraig@skadden.com
gdotson@americanprogress.org
georgetownlawmediarelations@law.georgetown.edu
georgetownp2ptutoring@gmail.com
ger@hillaryclinton.com
ghcecil@gmail.com
ghirshberg@stonyfield.com
ghouser.hrc@gmail.com
gkaplan@kslaw.com
gkimbrell@centerforfoodsafety.org
glamarche@democracyalliance.org
gmail.com@email.ericgarcetti.com
gmail.com@googlegroups.com
gmail.com@list.prochoiceamerica.org
gmail.com@mail.newrepublic.com
gmail.com@mail.salsalabs.net
gmail.com@mail.vresp.com
gmail.com@mail138.atl171.mcdlv.net
gmail.com@mail143.atl101.mcdlv.net
gmail.com@mail143.atl171.mcdlv.net
gmail.com@mail155.atl101.mcdlv.net
gmail.com@mail165.atl61.mcsv.net
gmail.com@mail176.atl121.mcsv.net
gmail.com@mail177.suw14.mcdlv.net
gmail.com@mail178.atl171.mcdlv.net
gmail.com@mail18.wdc01.mcd
gmail.com@mail182.wdc02.mcdlv.net
gmail.com@mail183.atl81.rsgsv.net
gmail.com@mail189.suw16.rsgsv.net
gmail.com@mail20.suw15.mcsv.net
gmail.com@mail21.suw11.mcdlv.net
gmail.com@mail24.suw11.mcdlv.net
gmail.com@mail30.atl51.rsgsv.net
gmail.com@mail31.wdc01.mcdlv.net
gmail.com@mail36.atl31.mcdlv.net
gmail.com@mail38.suw17.mcsv.net
gmail.com@mail44.wdc01.mcdlv.net
gmail.com@mail48.suw13.rsgsv.net
gmail.com@mail52.atl161.mcsv.net
gmail.com@mail69.atl161.mcsv.net
gmail.com@mail73.atl111.rsgsv.net
gmail.com@mail88.atl31.mcdlv.net
gmail.com@mail9.atl161.mcsv.net
gmail.com@morning1.theskimm.com
gmail.com@morning2.theskimm.com
gmaniatis@gmail.com
gmcgowan@podestagroup.com
gmilne@clintonfoundation.org
gmk9@law.georgetown.edu
gmsmlwad3sgayh8uxahttfgg@mail.gmail.com
gn@googlegroups.com
goff@hillaryclinton.com
golis@gmmb.com
googlegroups-manage+1010994788769+unsubscribe@googlegroups.com
googlegroups-manage+112021531214+unsubscribe@googlegroups.com
googlegroups-manage+220353843114+unsubscribe@googlegroups.com
googlegroups-manage+229003166705+unsubscribe@googlegroups.com
googlegroups-manage+252889165983+unsubscribe@googlegroups.com
googlegroups-manage+301712100758+unsubscribe@googlegroups.com
googlegroups-manage+329678006109+unsubscribe@googlegroups.com
googlegroups-manage+454025518715+unsubscribe@googlegroups.com
googlegroups-manage+612515467801+unsubscribe@googlegroups.com
gostin@law.georgetown.edu
gottemoellerre@state.gov
gpataki@chadbourne.com
gq@mail.gmail.com
grahamallison@belfercenter.hks.harvard.edu
grammayolo@hillz.com
grannyangela@gmail.com
grant@lundberg.com
grassroots@aipac.org
grassrootsdata@hillaryclinton.com
greg.pinelo@gmmb.co
greg.pinelo@gmmb.com
grosalsky@progressivemediausa.org
gruncom@aol.com
gthaler@hillaryclinton.com
gthompson@pascla.org
guillens@citi.com
gun@alumni.stanford.edu
gvruqqvl89nqj8zakhsmq@mail.gmail.com
gwg3riehgsm8q@mail.gmail.com
h-syxyee87q@mail.gmail.com
h1wea@mail.gmail.com
h3vjyqde6iejhvjrfk_mhabe12_a1qh04q@mail.gmail.com
h@dixondavismedia.com
h@dnc.org
ha16@hillaryclinton.co
ha16@hillaryclinton.com
ha374@georgetown.edu
haikley@clintonfoundation.org
hake@hillaryclinton.com
halifaxtheforum.org@mail131.atl171.mcdlv.net
halifaxtheforum.org@mail24.atl91.mcsv.net
halle@hillaryclinton.com
hannah@presidentclinton.com
hansen@consumer.org
happ@wilsoncenter.org
hberman@cov.co
hberman@cov.com
hbook@hillaryclinton.com
hboushey@equitablegrowth.org
hbursch@usip.org
hcclips34174921@hillaryclinton.com
hd22@clintonemail.com
hdpf@msn.com
hdr22@clintonemail.co
hdr22@clintonemail.com
hdr29@hrcoffice.com
hdrafts@hillaryclinton.com
healthlist@googlegroups.com
heather.samuelson@gmail.com
helan@gmail.com
helen.clarke@virgin.com
help@law.georgetown.edu
hens@naturespath.com
her@hillaryclinton.com
heryl.mills@gmail.com
hfxwf+ihfvrgza2snjey-zpbg@mail.gmail.com
hgrey@hillaryclinton.com
hhbglxyyq@mail.gmail.com
hhendler@agendaproject.org
hiattf@washpost.com
hickes@ickesenright.com
hillaryclinton@wallstreet.com
hindy@brand-sphere.com
hit-reply@linkedin.com
hkirstein@hillaryclinton.com
hkliegman@podestagroup.com
hl580@georgetown.edu
hl@hillaryclinton.com
hms@sandlerfoundation.or
hms@sandlerfoundation.org
hmwmdtrbuwnvwetzaj86pwk4d0pq@mail.gmail.com
hn.podesta@gmail.com
hn@algpolling.com
hnmccain@gop.com
hnqmnpv0stn3sv2huud9fshb6vfgwn-3q@mail.gmail.com
howdhry@ricehadleygates.com
hoya2007@gmail.com
hphmy234tpjs7dlg6ea81f79abe0uaj.aj.1346338843@bronto.com
hrc@gmail.com
hrcrapid+bncbc33vbfm44prbyuq5guqkgqeurpwvtq@googlegroups.com
hrcrapid+bncbc4zxhos2uobb6f2vsuqkgqexgazzhq@googlegroups.com
hrcrapid+bncbc4zxhos2uobb74w5guqkgqedenhz5y@googlegroups.com
hrcrapid+bncbc4zxhos2uobbt566suqkgqeezzbvpa@googlegroups.com
hrcrapid+bncbc4zxhos2uobbv62vsuqkgqej72w5mq@googlegroups.com
hrcrapid+bncbc62zkhyvqjrb4er42uqkgqekg2sazy@googlegroups.com
hrcrapid+bncbc62zkhyvqjrbhhp7cuqkgqe4wk7pfy@googlegroups.com
hrcrapid+bncbc62zkhyvqjrbsnlw2uqkgqedkmdcea@googlegroups.com
hrcrapid+bncbc62zkhyvqjrbxem5guqkgqe3qp2upq@googlegroups.com
hrcrapid+bncbce3pxf5yaarb2en7ouqkgqeveakgpi@googlegroups.com
hrcrapid+bncbce3pxf5yaarbxmg5guqkgqeqjcqmia@googlegroups.com
hrcrapid+bncbcek7xxbyepbb2hr4kvqkgqeua23vwi@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbb2vlyovqkgqeqwkrjsi@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbb3peqkwakgqepsj7qda@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbb5fz7gvakgqeqopbeni@googlegroups.com
hrcrapid+bncbcek7xxbyepbb75qvcvakgqe4q7gmbi@googlegroups.com
hrcrapid+bncbcek7xxbyepbb7gd76wakgqeaulg4ei@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbb7h2y2vqkgqerih4w5a@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbbag772vakgqeq2kcjki@googlegroups.com
hrcrapid+bncbcek7xxbyepbbdez6svakgqeoarm7si@googlegroups.com
hrcrapid+bncbcek7xxbyepbbdgdu6wakgqepkga6bi@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbbdmm56vakgqeovwrgaq@googlegroups.com
hrcrapid+bncbcek7xxbyepbbe6z3wvqkgqeropseeq@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbbepfx2wqkgqe2npr4na@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbbgwuuovqkgqe2v2vpvq@googlegroups.com
hrcrapid+bncbcek7xxbyepbbk7xwgvqkgqei74sy5a@googlegroups.com
hrcrapid+bncbcek7xxbyepbbnmlu2wqkgqec55zy5y@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbbnp2wwwqkgqeyl3rzry@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbbqfxtgvqkgqeve2v4jq@googlegroups.com
hrcrapid+bncbcek7xxbyepbbqhe6swakgqeezotg7y@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbbqvhuwvakgqefnjhjeq@googlegroups.com
hrcrapid+bncbcek7xxbyepbbru6s2wqkgqeu4ezuxa@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbbrxn2gwakgqe3eobyyy@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbbthj26vakgqenw7v3ni@googlegroups.com
hrcrapid+bncbcek7xxbyepbbtohtowqkgqepomk5ry@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbbumxw6vqkgqeg76smri@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbbwxwucwqkgqezrmsevi@hillaryclinton.com
hrcrapid+bncbcek7xxbyepbbynz3cvqkgqec35vhrq@hillaryclinton.com
hrcrapid+bncbcgzp64uxqjrbfgkxkwakgqek3erh4q@hillaryclinton.com
hrcrapid+bncbcmzle4zqycbbevtvsuqkgqedlu3pgq@googlegroups.com
hrcrapid+bncbcmzle4zqycbbhxu52uqkgqezjkqh3i@googlegroups.com
hrcrapid+bncbcmzle4zqycbbl4j22uqkgqe335atpy@googlegroups.com
hrcrapid+bncbcmzle4zqycbbquzsc2qkgqeai26fvq@googlegroups.com
hrcrapid+bncbcmzle4zqycbbzv3vsuqkgqekwj23uq@googlegroups.com
hrcrapid+bncbctntqvnbminhk5qvqcrubcmiini6@hillaryclinton.com
hrcrapid+bncbcv3pf6a7igbb7ecwguqkgqelrsjsdq@googlegroups.com
hrcrapid+bncbcx2l4gptacrb2o72wuqkgqewgxbc5y@googlegroups.com
hrcrapid+bncbcx2l4gptacrb4ghqwvakgqearyir2y@googlegroups.com
hrcrapid+bncbcx2l4gptacrb5mq5guqkgqezyqgrgq@googlegroups.com
hrcrapid+bncbcx2l4gptacrbavfw2uqkgqe7eg6rba@googlegroups.com
hrcrapid+bncbcx2l4gptacrbhfd2guqkgqei3miniq@googlegroups.com
hrcrapid+bncbcx2l4gptacrbhhy6ouqkgqe4bpfxaa@googlegroups.com
hrcrapid+bncbcx2l4gptacrbjmf4guqkgqethmgdja@googlegroups.com
hrcrapid+bncbcx2l4gptacrbku75guqkgqebxlofji@googlegroups.com
hrcrapid+bncbcx2l4gptacrbx6z6ouqkgqevzvefii@googlegroups.com
hrcrapid+bncbcx2l4gptacrbzhnxouqkgqel3rpl6a@googlegroups.com
hrcrapid+bncbcx53lhruenrb34cwsvqkgqeaogypbq@googlegroups.com
hrcrapid+bncbcx53lhruenrb4ob7gvakgqe5527efa@googlegroups.com
hrcrapid+bncbcx53lhruenrbimrwguqkgqearg5leq@googlegroups.com
hrcrapid+bncbcx53lhruenrbmno4guqkgqeibkgjwy@googlegroups.com
hrcrapid+bncbcxoxweo7embbm4ewguqkgqeo6qdhgq@googlegroups.com
hrcrapid+bncbcxoxweo7embbp4gwguqkgqekslrqmy@googlegroups.com
hrcrapid+bncbcxoxweo7embbww66ouqkgqeugg6hii@googlegroups.com
hrcrapid+bncbcyorz7quegrb4mz4wuqkgqe5drousy@googlegroups.com
hrcrapid+bncbcyorz7quegrbof77cuqkgqem3qtoly@googlegroups.com
hrcrapid+bncbcyorz7quegrbt7q52uqkgqe6pdtmfi@googlegroups.com
hrcrapid+bncbczir3nhw4gbbhhq6ouqkgqenqvt77i@googlegroups.com
hrcrapid+bncbd77zthxbqiiv4oavmcrubbhbvxkc@hillaryclinton.com
hrcrapid+bncbd77zthxbqiivi4rvucrubbo5lloq@hillaryclinton.com
hrcrapid+bncbd77zthxbqijj7hkvmcrubbpig3d6@hillaryclinton.com
hrcrapid+bncbd77zthxbqijnqnsvicrubg757ttc@googlegroups.com
hrcrapid+bncbd77zthxbqijptghvicrubactvi74@googlegroups.com
hrcrapid+bncbd77zthxbqijrm55vicrubfze4jag@googlegroups.com
hrcrapid+bncbd77zthxbqikh3uvvqcrubfaf2xps@hillaryclinton.com
hrcrapid+bncbd77zthxbqiktpervmcrubbxep2b6@googlegroups.com
hrcrapid+bncbd77zthxbqikxrehvmcrubfzig5qy@googlegroups.com
hrcrapid+bncbd77zthxbqikzmw7vqcrubck7zlfg@hillaryclinton.com
hrcrapid+bncbd77zthxbqilba6ovucruban63ggw@hillaryclinton.com
hrcrapid+bncbd77zthxbqild6wlvmcrubgu26ueu@hillaryclinton.com
hrcrapid+bncbd77zthxbqilfhnjvucrubfvtbq3y@hillaryclinton.com
hrcrapid+bncbd77zthxbqilfufyvucrubcqslgri@hillaryclinton.com
hrcrapid+bncbd77zthxbqilj56mvicrubfuglcmc@googlegroups.com
hrcrapid+bncbd77zthxbqilrs5pvqcrubdtyivbs@hillaryclinton.com
hrcrapid+bncbd77zthxbqim5j5wvmcrubgduladi@hillaryclinton.com
hrcrapid+bncbd77zthxbqim5w7fvmcrubdams7e2@hillaryclinton.com
hrcrapid+bncbd77zthxbqimbcxuvqcruba3nqj2s@hillaryclinton.com
hrcrapid+bncbd77zthxbqimff6avqcrubghgf3pq@hillaryclinton.com
hrcrapid+bncbd77zthxbqimhlgxvicrubgein4gs@googlegroups.com
hrcrapid+bncbd77zthxbqimldnmvmcrubhj7wgeq@hillaryclinton.com
hrcrapid+bncbd77zthxbqimpf6tvucrubh5wbiss@hillaryclinton.com
hrcrapid+bncbd77zthxbqimtixhvicrubfxlg5zc@googlegroups.com
hrcrapid+bncbd77zthxbqin3cuavqcrubgsubdrc@hillaryclinton.com
hrcrapid+bncbd77zthxbqinfn7evqcrubhhgtvbq@hillaryclinton.com
hrcrapid+bncbd77zthxbqinjbvovucrubh4kvqic@hillaryclinton.com
hrcrapid+bncbd77zthxbqinjduevucrubhulu53a@hillaryclinton.com
hrcrapid+bncbd77zthxbqinjgogvmcrubgri74ai@hillaryclinton.com
hrcrapid+bncbd77zthxbqinlmftvucrubhpsu2wi@hillaryclinton.com
hrcrapid+bncbd77zthxbqinlpxcvicrubavioiqi@googlegroups.com
hrcrapid+bncbd77zthxbqinxkfkvqcrubefhtpj2@hillaryclinton.com
hrcrapid+bncbd77zthxbqinzjwrvmcrubf6gtd6e@hillaryclinton.com
hrcrapid+bncbd77zthxbqio3jm6vucrubatbluzc@hillaryclinton.com
hrcrapid+bncbd77zthxbqio3mujvucrubdbmp7mo@hillaryclinton.com
hrcrapid+bncbd77zthxbqio7lgcvicrubgpkt3wq@googlegroups.com
hrcrapid+bncbd77zthxbqiofem3vqcrubf6qhtds@hillaryclinton.com
hrcrapid+bncbd77zthxbqiojvppvmcrubbyj5nom@hillaryclinton.com
hrcrapid+bncbd77zthxbqiotqemvmcrubc5mjcdc@googlegroups.com
hrcrapid+bncbd77zthxbqiozzhrvicrubd452ik4@googlegroups.com
hrcrapid+bncbd77zthxbqipb4nuvqcrubazpng7g@hillaryclinton.com
hrcrapid+bncbd77zthxbqipn6fhvicrubeay3vcg@googlegroups.com
hrcrapid+bncbd77zthxbqiptiucvmcrubccks6xq@googlegroups.com
hrcrapid+bncbd77zthxbqiptrpmvicrubg2g6lx6@googlegroups.com
hrcrapid+bncbd7zbpmevehbb26fw6uqkgqe765u4qi@googlegroups.com
hrcrapid+bncbd7zbpmevehbbch2wcuqkgqeixvdafy@googlegroups.com
hrcrapid+bncbd7zbpmevehbbe664cuqkgqevh4nggy@googlegroups.com
hrcrapid+bncbd7zbpmevehbbg5rvsuqkgqepnbnxna@googlegroups.com
hrcrapid+bncbd7zbpmevehbbtup4wuqkgqeg77zyca@googlegroups.com
hrcrapid+bncbd7zbpmevehbbzo3vsuqkgqehsewtwi@googlegroups.com
hrcrapid+bncbdc5b46bwenbbavyw2uqkgqehgywdjq@googlegroups.com
hrcrapid+bncbdc5b46bwenbbr6bycuqkgqen3hlmsa@googlegroups.com
hrcrapid+bncbde4tggzwyerbjng3gwqkgqe5nyz5fq@hillaryclinton.com
hrcrapid+bncbde4tggzwyerbmunzowqkgqenwzmuay@hillaryclinton.com
hrcrapid+bncbdezde6z2yfbbk434wuqkgqezbbp6uq@googlegroups.com
hrcrapid+bncbdezde6z2yfbbsfzvsuqkgqe2wuyvia@googlegroups.com
hrcrapid+bncbdfnxj5a3mfbbrpn6ouqkgqedqpt2yq@googlegroups.com
hrcrapid+bncbdj25cfnziirb6nyvsuqkgqeknk5wqa@googlegroups.com
hrcrapid+bncbdj25cfnziirbe4y5guqkgqejloyouy@googlegroups.com
hrcrapid+bncbdj25cfnziirbphk3kuqkgqetml3sqy@googlegroups.com
hrcrapid+bncbdj25cfnziirbqgr22uqkgqeupqbmbq@googlegroups.com
hrcrapid+bncbdj25cfnziirbqhu6ouqkgqeljyl3ai@googlegroups.com
hrcrapid+bncbdj25cfnziirbqmk22uqkgqenvvhc6i@googlegroups.com
hrcrapid+bncbdl5daehwenrb2em3suqkgqe2m2nvga@googlegroups.com
hrcrapid+bncbdl5daehwenrb3oetcvakgqeimrnf5i@googlegroups.com
hrcrapid+bncbdl5daehwenrb5ea7guqkgqek3utcai@googlegroups.com
hrcrapid+bncbdl5daehwenrbgvf4suqkgqejvx5tya@googlegroups.com
hrcrapid+bncbdl5daehwenrbmnow2uqkgqegu4qrzy@googlegroups.com
hrcrapid+bncbdl5daehwenrbo6462uqkgqehiqutci@googlegroups.com
hrcrapid+bncbdl5daehwenrbsxn6ouqkgqejq6csmq@googlegroups.com
hrcrapid+bncbdwi7nvt2umrbcgjykvakgqengslthq@googlegroups.com
hrcrapid+bncbdwi7nvt2umrbzmp22uqkgqepnndc6y@googlegroups.com
hrcrapid+bncbdy7v76qwqbrbc4wwguqkgqe74avxzy@googlegroups.com
hrcrapid+help@googlegroups.com
hrcrapid+help@hillaryclinton.com
hrcrapid+owners@googlegroups.com
hrcrapid+owners@hillaryclinton.com
hrcrapid+subscribe@hillaryclinton.com
hrcrapid+unsubscribe@googlegroups.com
hrcrapid@googlegroups.com
hrcrapid@hillaryclinton.com
hrcrr+unsubscribe@hillaryclinton.com
hrcrr@hillaryclinton.co
hrcrr@hillaryclinton.com
hrhuvtnbka@mail.gmail.com
hrichert@clintonfoundation.org
hrnorth@hevanet.co
hrnorth@hevanet.com
hrod17@clintonemail.com
hrod@clintonemail.com
hrtsleeve@gmail.com
hsamuelson@cdmillsgroup.com
hstone@hillaryclinton.co
hstone@hillaryclinton.com
hudson.org@cmail1.com
hudson.org@cmail19.com
hudson.org@cmail2.com
hudson.org@cmail20.com
hudsoninstitute-eckld1otlyhykh1i@cmail1.com
hudsoninstitute-jhlduul1xdtludjy1i@cmail1.com
hudsoninstitute-jkhjtty1otlyhykh1i@cmail1.com
hudsoninstitute-jtdhad1xdtludjy1i@cmail1.com
hudsoninstitute-jtkyjrl1otlyhykh1i@cmail2.com
hudsoninstitute-jttknl1otlyhykh1i@cmail1.com
hudsoninstitute-jyurljk1xdtludjy1i@cmail19.com
hudsoninstitute-tlktlyd1otlyhykh1i@cmail2.com
hudsoninstitute-vujijl1otlyhykh1i@cmail2.com
hudsoninstitute-vuytit1xdtludjy1i@cmail2.com
huma@clintonemail.com
huma@clintonfoundation.org
huma@hrcoffice.co
huma@hrcoffice.com
hur@hillaryclinton.com
hwerin@gmail.com
hwerin@hillaryclinton.com
hwerin@hrcoffice.com
hxfgpqxeju6g1zhds1otn+7aa@mail.gmail.com
hy@nytimes.com
i7nj72e7aapyjgvrllmxq6fgqvqomid+anap3zew@mail.gmail.com
i@gmail.com
i@hillaryclinton.com
i_g_temxujp1a@mail.gmail.com
ian.mandel@gmail.com
ian@progressiveaccountability.org
ianefallon@gmail.com
iari@hillaryclinton.com
ibhatty@ussc.gov
ic2008@gqrr.com
ices@politicopro.com
id@db-research.com
id@dixondavismedia.com
ie@progressiveaccountability.org
ieqbbsx39cd_s5gzwdj3w@mail.gmail.com
ier@gmail.com
ieri@gmail.com
ieri@hillaryclinton.com
ifer.m.palmieri@gmail.com
ifta@gmail.com
iginaluser@asc.upenn.edu
igoldenberg@nsnetwork.org
igor.bobic@huffingtonpost.com
ihss.consumers.union@gmail.com
ik292@georgetown.edu
il.com@mail18.wdc01.mcdlv.net
ill.hrco@gmail.com
ill@hrcoffice.com
im.margolis@gmmb.com
imbrell@centerforfoodsafety.org
imisadmin@csis.org
imk6@georgetown.edu
in@gmail.com
in@hillaryclinton.com
in@hotmail.com
in@hrcoffice.com
ina@presidentclinton.com
inakschake@gmail.com
incoming@hillaryclinton.com
ine.whitney@skadden.com
info2@indiagov.org
info@2x.png
info@actblue.com
info@americansecurityproject.org
info@backbonecampaign.org
info@backbonecampaign.orgweb
info@barackobama.com
info@belfercenter.hks.harvard.edu
info@businessfwd.org
info@centerpeace.org
info@cubacentral.com
info@ericgarcetti.com
info@forwardengagement.org
info@garamendi.org
info@geneticsandsociety.org
info@globalasia.org
info@gop.com
info@halifaxtheforum.org
info@hudson.org
info@jayfootlik.com
info@johndouglassforcongress.com
info@kirkpatrickforarizona.com
info@kirkpatrickforsenate.com
info@nancyroteringforcongress.com
info@ppionline.org
info@progressohio.org
info@seanmaloney.com
info@spiritualprogressives.org
info@tnr.com
info@votevets.org
inquiries@mikvachallenge.org
insct@syr.edu
intlaw@americanbar.org
ionratiu-award@wilsoncenter.org
ip@aipac.org
ips@gmail.com
ir@hrcoffice.com
iraqcampaign@googlegroups.com
irect@nytimes.com
irshberg@stonyfield.com
irstdraft@nytimes.com
is@gmmb.com
is@hillaryclinton.com
isagravitz@greenamerica.org
isams@hillaryclinton.co
isams@hillaryclinton.com
isher@hillaryclinton.com
iskx+yarw@mail.gmail.com
issues@hillaryclinton.com
istinakschake@gmail.com
itamar.mann@gmail.com
iucbdianfaa@mail.gmail.com
ivan@gmail.com
ivan@hillaryclinton.com
ivanfrishberg@gmail.com
izenstat@cov.com
j6p8jhlk8rwww2mtozs0ah90bebopa@mail.gmail.com
j9cghkwa2nfcfosg@mail.gmail.com
ja@mail.gmail.com
jabell@thehawkeye.com
jac6euj03o+hbse0qwhbwzqq@mail.gmail.com
jackson.diehl@washpost.com
jacob.sullivan@yale.edu
jacob@progressiveaccountability.org
jadler@adleradr.com
jairam54@gmail.com
jake.sullivan@gmail.co
jake.sullivan@gmail.com
james.grimaldi@wsj.com
james.n.miller.jr@gmail.com
james.rubin@bcpartners.com
james@sandlerfoundation.org
james_h_stock@cea.eop.gov
jamesprubin1960@gmail.com
jamillah.williams@law.georgetown.edu
jandrews@jacompany.com
janinebk@me.com
jans@naturespath.com
jason_l_furman@cea.eop.gov
jbarigazzi@politico.eu
jbattle@albrightstonebridge.com
jbecker@nytimes.com
jbenenson@bsgco.co
jbenenson@bsgco.com
jbunch@denverpost.com
jc2403@law.georgetown.edu
jchurch@americanbridge.org
jcirincione@ploughshares.org
jdorner@americanprogress.or
jdorner@americanprogress.org
jeb@jeb.org
jeb@jebbush.org
jeb@myflorida.com
jec@law.georgetown.edu
jeff@algpolling.com
jeff@progressiveaccountability.org
jeffrey@seedsofdeception.com
jeffrey_smith@aporter.com
jenna_ebert@lcv.org
jennifer.m.palmieri@gmail.co
jennifer.m.palmieri@gmail.com
jennifer0willis@gmail.com
jennifer@diannefeinsteinforsenate.com
jennifer_m_palmieri@who.eop.gov
jennifer_pae@mail.vresp.com
jennymayfield@stanford.edu
jeremy.jacobs@thehill.com
jeremybash@gmail.com
jerryncastro@gmail.com
jesse.demastrie@gmmb.co
jesse.demastrie@gmmb.com
jesse@jesseferguson.com
jessica@jstreet.org
jessica_e_schumer@cea.eop.gov
jeyup.kwaak@wsj.com
jferguson@hillaryclinton.co
jferguson@hillaryclinton.com
jfernandez@gibsondunn.com
jfferg@gmail.com
jfreedman@albrightstonebridge.com
jg@rock-creek-ventures.com
jgendelman@americanprogress.org
jgerstein@democracycorps.com
jgraham@fairviewinsurance.com
jhalloran@consumer.org
jhcanterbury@pascla.org
jim.margolis@gmmb.co
jim.margolis@gmmb.com
jim.messina@ptt.gov
jim@leahymg.com
jim@thoughtstep.net
jlambrew@mail.utexas.edu
jlaszczych@cdmillsgroup.com
jlehrich@hillaryclinton.co
jlehrich@hillaryclinton.com
jlowenstein@hillaryclinton.com
jlrhalpin@gmail.com
jmacek@gqrr.com
jmarks@politico.com
jmassey@hillaryclinton.co
jmassey@hillaryclinton.com
jmb386@law.georgetown.edu
jmcclain@hillaryclinton.com
jmd@mit.edu
jmeek@nydailynews.com
jmroney@earthpolicy.org
jmueller@hillaryclinton.co
jmueller@hillaryclinton.com
jmwstckmg4dnq@mail.gmail.com
jneurohr@americanprogressaction.org
jnichols@madison.com
jnorman@dmreg.com
jnorris@americanprogress.org
jnorton@skdknick.com
jnup7vhz4y-8sd_3w@mail.gmail.com
jobrien@albrightstonebridge.co
jobrien@albrightstonebridge.com
jobs@risingtideinteractive.com
jofarin@hotmail.com
jog@mail.gmail.com
john.podesta@gmail.co
john.podesta@gmail.com
john.podesta@ptt.gov
john.rimel@gmmb.com
john@algpolling.co
john@algpolling.com
john@nutiva.com
john_d_podesta@who.eop
john_d_podesta@who.eop.gov
john_mccain@mccain.senate.gov
john_p._holdren@ostp.eop.gov
johnmccain@gop.com
johnpodesta@gmail.com
johnpodestatemp@outlook.com
johnson_lo@mail2000.com.tw
jon@presidentclinton.com
jonathan.keim@gmail.com
jonwdeli@gmail.com
jorgevilches@fibertel.co
jorgevilches@fibertel.com.ar
joseph.zernik@hra-ngo.org
josh.dorner@sierraclub.org
josh_hicks@lcv.org
joshschwerin@gmail.com
joshua.steiner@quadranglegroup.com
joshua_mcneil@lcv.org
jp66@hillaryclinton.co
jp66@hillaryclinton.com
jpalmieri@hillaryclinton.co
jpalmieri@hillaryclinton.com
jplucinska@politico.eu
jpodesta@americanprogress.org
jpodesta@hillaryclinton.com
jpodesta@who.eop.gov
jreynoso@stblaw.com
jroberts@progressivemediausa.org
jrosenbaum@hillaryclinton.com
jrubinblogger@gmail.com
jsalt@catholics-united.org
jschwerin@hillaryclinton.co
jschwerin@hillaryclinton.com
jslovinec16@hotmail.com
jsmtwezuqzxpd3msodnom7srmo5smudjw1jj8wg@mail.gmail.com
jsnead@kslaw.com
jstewart@albrightstonebridge.com
jstocks@nea.org
jsullivan@hillaryclinton.co
jsullivan@hillaryclinton.com
jtaylor@niskanencenter.org
jtelep@kslaw.com
jthomisee@barackobama.com
julia.tomassetti@gmail.com
julian@devinemulvey.com
julius@genachowski.com
julsmi@gmail.com
jumurray@gmail.com
juno@genius-network.com
justin@presidentclinton.com
k-7rebanzcfc7g@mail.gmail.com
k0w@mail.gmail.com
k2015@gmail.com
k3i+r9ya@mail.gmail.com
k3x_46dj3rzwxy93sryqv9zcdwmf1jx3g@mail.gmail.com
k7cdoq5whqmaiawipuw@mail.gmail.com
k7falvgq@mail.gmail.com
k@gmail.com
k@hillaryclinton.com
k@skdknick.com
kamyl@chelseaoffice.com
kanderson@nea.org
kara.l.nichols@gmail.com
karen.l.dunn@gmail.com
karen.sack@oceanunite.org
kastel@cornucopia.org
katbarr07@gmail.com
kate.sheppard@huffingtonpost.com
kate_geller@lcv.org
katherine@organicconsumers.org
kathleen@corridorpartners.com
katie.w.dowd@gmail.com
katrina@justlabelit.org
katy_kale@yahoo.com
kay@tikkun.org
kchanpng.nhforhillary@gmail.com
kchanpong.nhforhillary@gmail.com
kconnolly@bsgco.com
kcosta@hillaryclinton.com
kcrummy@denverpost.com
kdowd@hillaryclinton.com
ke@gmail.com
ke@hillaryclinton.com
kelli@progressiveaccountability.org
ken@ewg.or
ken@ewg.org
ken@ndi.org
kennan@wilsoncenter.org
kevinmcaleenan@yahoo.com
kfarr@progressivemediausa.org
kfinney@hillaryclinton.co
kfinney@hillaryclinton.com
kfkqgdzsy+s5pem6wdf7pq@mail.gmail.com
kfrisch@mediamatters.org
kfuksa@gqrr.com
kg@mail.gmail.com
khamerschlag@foe.or
khamerschlag@foe.org
kholloway@albrightstonebridge.com
kimberly.atkins@bostonherald.com
kingnews@politico.com
kjohnson@barackobama.com
kjww@mail.gmail.com
klain@revolution.com
klfnqi6car2kuh_4a0ta15eigjvbowzaa@mail.gmail.com
klieberthal@brookings.edu
kmiller@thehawkeye.com
knowledgesummits@gmail.com
kofferdahl@hillaryclinton.co
kofferdahl@hillaryclinton.com
kolick@skdknick.com
kos@stanford.edu
kounalakis@gmail.com
kounalakiset@gmail.com
kqx708sqbjgznla-da_wta@mail.gmail.com
kristinakschake@gmail.co
kristinakschake@gmail.com
kschake@gmail.com
kschake@hillaryclinton.co
kschake@hillaryclinton.com
ksofer@americanprogress.org
ksoligan@mediamatters.org
kstrand@hillaryclinton.com
ksumisaki@sandlerfoundation.or
ksumisaki@sandlerfoundation.org
kswifta@gmail.com
kthomas@ap.org
kthurman@hillaryclinton.com
kturner@wc.com
kukzxw@mail.gmail.com
kurtmcampbell@yahoo.com
kussa@saban.com
kw39hnef9lza+p_pvcbbm8yeoibdy7ry6v7qg@mail.gmail.com
kwhite@nea.org
kwodhfkd7whehswa8ovp8r9r+rkyqmsagw@mail.gmail.com
l.mills@gmail.com
l.schweizer@wholefoods.com
l1rpqscq@mail.gmail.com
l9dfpbnahctm9w@mail.gmail.com
l@2x.png
l@cornucopia.org
l@gmmb.com
l@hillaryclinton.com
lacich@hillaryclinton.com
ladams@hillaryclinton.com
larcher@foe.org
larry@tribelaw.com
larrybrilliant@gmail.com
latham@hillaryclinton.com
laura_nichols@mpaa.org
laurasnichols@yahoo.com
law.georgetown.edu@478.vx-email.com
law.georgetown.edu@georgetown.edu
law.georgetown.edu@mail128.wdc02.mcdlv.net
law.georgetown.edu@mail13.atl161.mcsv.net
law.georgetown.edu@mail130.wdc02.mcdlv.net
law.georgetown.edu@mail131.atl171.mcdlv.net
law.georgetown.edu@mail141.wdc01.mcdlv.net
law.georgetown.edu@mail146.atl21.rsgsv.net
law.georgetown.edu@mail147.atl61.mcsv.net
law.georgetown.edu@mail151.atl171.mcdlv.net
law.georgetown.edu@mail152.suw16.rsgsv.net
law.georgetown.edu@mail155.atl171.mcdlv.net
law.georgetown.edu@mail164.atl171.mcdlv.net
law.georgetown.edu@mail164.atl61.mcsv.net
law.georgetown.edu@mail168.atl101.mcdlv.net
law.georgetown.edu@mail169.atl171.mcdlv.net
law.georgetown.edu@mail170.atl171.mcdlv.net
law.georgetown.edu@mail171.wdc02.mcdlv.net
law.georgetown.edu@mail172.wdc02.mcdlv.net
law.georgetown.edu@mail175.atl81.rsgsv.net
law.georgetown.edu@mail182.atl101.mcdlv.net
law.georgetown.edu@mail183.atl81.rsgsv.net
law.georgetown.edu@mail186.suw14.mcdlv.net
law.georgetown.edu@mail187.atl101.mcdlv.net
law.georgetown.edu@mail188.atl21.rsgsv.net
law.georgetown.edu@mail189.suw16.rsgsv.net
law.georgetown.edu@mail190.atl171.mcdlv.net
law.georgetown.edu@mail191.atl121.mcsv.net
law.georgetown.edu@mail191.wdc02.mcdlv.net
law.georgetown.edu@mail192.wdc02.mcdlv.net
law.georgetown.edu@mail199.atl101.mcdlv.net
law.georgetown.edu@mail20.suw15.mcsv.net
law.georgetown.edu@mail20.us4.mcsv.net
law.georgetown.edu@mail200.suw14.mcdlv.net
law.georgetown.edu@mail208.atl171.mcdlv.net
law.georgetown.edu@mail210.atl21.rsgsv.net
law.georgetown.edu@mail211.suw14.mcdlv.net
law.georgetown.edu@mail215.atl61.mcsv.net
law.georgetown.edu@mail215.suw16.rsgsv.net
law.georgetown.edu@mail217.atl21.rsgsv.net
law.georgetown.edu@mail22.us4.mcsv.net
law.georgetown.edu@mail222.atl21.rsgsv.net
law.georgetown.edu@mail23.us4.mcsv.net
law.georgetown.edu@mail24.atl91.mcsv.net
law.georgetown.edu@mail25.suw17.mcsv.net
law.georgetown.edu@mail3.wdc03.rsgsv.net
law.georgetown.edu@mail34.atl71.mcdlv.net
law.georgetown.edu@mail34.atl91.mcsv.net
law.georgetown.edu@mail34.suw17.mcsv.net
law.georgetown.edu@mail36.wdc03.rsgsv.net
law.georgetown.edu@mail38.atl11.rsgsv.net
law.georgetown.edu@mail39.atl31.mcdlv.net
law.georgetown.edu@mail39.atl71.mcdlv.net
law.georgetown.edu@mail40.atl111.rsgsv.net
law.georgetown.edu@mail42.suw15.mcsv.net
law.georgetown.edu@mail44.atl111.rsgsv.net
law.georgetown.edu@mail44.suw15.mcsv.net
law.georgetown.edu@mail46.atl11.rsgsv.net
law.georgetown.edu@mail46.atl71.mcdlv.net
law.georgetown.edu@mail48.suw11.mcdlv.net
law.georgetown.edu@mail53.atl31.mcdlv.net
law.georgetown.edu@mail54.atl51.rsgsv.net
law.georgetown.edu@mail55.atl111.rsgsv.net
law.georgetown.edu@mail56.atl51.rsgsv.net
law.georgetown.edu@mail6.us4.mcsv.net
law.georgetown.edu@mail65.suw15.mcsv.net
law.georgetown.edu@mail66.atl31.mcdlv.net
law.georgetown.edu@mail68.suw11.mcdlv.net
law.georgetown.edu@mail69.atl31.mcdlv.net
law.georgetown.edu@mail69.suw11.mcdlv.net
law.georgetown.edu@mail7.atl161.mcsv.net
law.georgetown.edu@mail71.atl111.rsgsv.net
law.georgetown.edu@mail72.suw15.mcsv.net
law.georgetown.edu@mail75.suw11.mcdlv.net
law.georgetown.edu@mail77.atl11.rsgsv.net
law.georgetown.edu@mail8.atl31.mcdlv.net
law.georgetown.edu@mail82.suw11.mcdlv.net
law.georgetown.edu@mail82.suw15.mcsv.net
law.georgetown.edu@mail9.atl71.mcdlv.net
law.georgetown.edu@mail90.atl161.mcsv.net
law.georgetown.edu@mail90.suw11.mcdlv.net
law.georgetown.edu@mail93.atl71.mcdlv.net
law.georgetown.edu@mail96.atl161.mcsv.net
law.georgetown.edu@mail98.atl71.mcdlv.net
law.georgetown.edu@mail99.atl11.rsgsv.net
law.georgetown.edu@mail99.atl51.rsgsv.net
law.georgetown.edu@q.go.com
lawcenterstaff@law.georgetown.edu
lawfacultyandvisitors@law.georgetown.edu
lawlibraryall@law.georgetown.edu
lcaplan3@gmail.com
ldh@stanford.edu
lds@hillaryclinton.com
le@progressivemediausa.org
leave-fd8916701a3c402029-fe9316747d65057571-ff2b15727c6c-fe881372756c027a7c-ff2b10797365@leave.morning7.theskimm.com
leave-fd8916701a3c402029-fe9316747d65057571-ff2b1579776c-fe881372756c027a7c-ff3410717562@leave.morning7.theskimm.com
leave-fd8916701a3c402029-fe9316747d65057571-ff3015717d61-fe881372756c027a7c-ff2b10797365@leave.morning7.theskimm.com
leave-fd8916701a3c402029-fe9316747d65057571-ff3315717d66-fe881372756c027a7c-ff2a10797366@leave.morning7.theskimm.com
leave-fd8916701a3c402029-fe9316747d65057571-ff3415717763-fe881372756c027a7c-ff251079716d@leave.morning7.theskimm.com
leave-fd8916701a3c402029-fe9316747d65057571-ff3715717562-fe881372756c027a7c-ff251079716d@leave.morning7.theskimm.com
leave-fd8916701a3c402029-fe9316747d65057571-ff5e137473-fe881372756c027a7c-ff2a10797067@leave.morning7.theskimm.com
leave-fd8916701a3c402029-fe9316747d65057571-ff6112707d-fe881372756c027a7c-ff2b10797066@leave.morning7.theskimm.com
leave-fd8916701a3c402029-fe9316747d65057571-ff611d7276-fe881372756c027a7c-ff2c10797065@leave.morning7.theskimm.com
leave-fd8916701a3c402029-fe9316747d65057571-ff65127071-fe881372756c027a7c-ff2b10797066@leave.morning7.theskimm.com
leave-fd8916701a3c402029-fe9316747d65057571-ff65137274-fe881372756c027a7c-ff2a10797067@leave.morning7.theskimm.com
leave-fd8916701a3c402029-fe9316747d65057571-ff66127375-fe881372756c027a7c-ff2910797060@leave.morning7.theskimm.com
leave-fd8916701a3c402029-fe9316747d65057571-ff67127077-fe881372756c027a7c-ff2b10797066@leave.morning7.theskimm.com
leave-fd8916701a3c402029-fe9316747d65057571-ff67127275-fe881372756c027a7c-ff2c10797065@leave.morning7.theskimm.com
leave-fd8916701a3c402029-fe9316747d65057571-ff69127075-fe881372756c027a7c-ff2b10797066@leave.morning7.theskimm.com
leave-public-5360117i@lists.earth-policy.org
lee@progressiveaccountability.org
legal@constantcontact.com
leibovitz@gmail.com
ler@hillaryclinton.com
leslie@glaserprogress.org
leslie@pogo.org
letters@nytimes.com
lewisje03@yahoo.com
lexis@organicconsumers.org
lgarvey@pogo.org
lgraham@clintonfoundation.org
lhartigan@saban.com
lhuber@albrightstonebridge.com
lindsay.shulman@one.org
lips@hillaryclinton.com
lis@gmmb.com
lisa@fooddemocracynow.org
lisa@progressiveaccountability.org
lisa_jackson@apple.com
lisabrown3660@gmail.com
list-unsubscribe@linkedin.com
listerk@gmail.com
littman@gmail.com
livan@gmail.com
livan@hillaryclinton.com
liz.oxhorn@gmmb.com
ljschweiger@larryschweiger.net
lkoffler@clintonfoundation.org
ll@centerforfoodsafety.org
ll@hrcoffice.com
llivan@gmail.com
llivan@hillaryclinton.com
llon@hillaryclinton.com
llone@drbronner.com
lls@cdmillsgroup.com
lls@gmail.com
lly@hotmail.com
lmieri@hillaryclinton.com
lmyers@reviewjournal.com
ln5nwd3c1qqwqbe8g@mail.gmail.com
lnavarro@calif-ilc.org
lon@hillaryclinton.com
lori@progressiveaccountability.org
lorraine@xeolux.com
lotte@brooklapping.com
louise.ridley@huffingtonpost.com
lpeterson@hillaryclinton.com
lpraeli@hillaryclinton.com
lrod@hillaryclinton.com
lrosenberger@hillaryclinton.co
lrosenberger@hillaryclinton.com
lruza@hillaryclinton.com
ls@gmail.com
lsaunders@afscme.org
lshyman@aol.com
lsilverberg@yahoo.com
lsmith@kslaw.com
ltch@americansecurityproject.org
lvalmoro@hrcoffice.com
lvizcaino@hillaryclinton.com
lwallace@hatcreekent.com
lxtu0axmrteem3pgjeapp4a@mail.gmail.com
ly@flextimeglobal.com
ly@google.com
m.margolis@gmmb.com
m.palmieri@gmail.com
m2016+bncbc7z72owzqerbkhlsspqkgqepucgscy@georgetown.edu
m2016+help@georgetown.edu
m2016+owners@georgetown.edu
m2016@georgetown.edu
m2dropgixkdqaj8st809efpekwkp3g@mail.gmail.com
m@aol.com
m@hillaryclinton.com
m_werz@web.de
ma@clintonfoundation.org
ma@hrcoffice.com
mabel_e._echols@omb.eop.gov
magazine@tikkun.org
maggie@pascla.org
maggielfox@gmail.com
mahony.christopher@gmail.com
mail@mail.nbcnews.com
mailer-daemon@googlemail.com
mailer_response@emailcounts.com
maker@podestagroup.onmicrosoft.com
manatos@manatos.com
manpiltch@americansecurityproject.org
manufacture@kslaw.com
manufacture@kslawemail.com
marcel.lettre@gmail.com
margaret@presidentclinton.com
margolis@gmmb.com
mariad.dossier@gmail.com
mariah.sixkiller@mail.house.gov
mariah6@gmail.com
marissa.astor@icloud.com
mark.murray@nbcuni.com
mark.safty@ucdenver.edu
mark@genatural.com
mark@progressiveaccountability.org
mark_johnson@shepherd.org
markos@stanford.edu
marlondmarshall@gmail.com
marshall@hillaryclinton.com
martin@glaserprogress.org
martin_feldstein@hks.harvard.edu
martyomoto@rcip.co
martyomoto@rcip.com
mastor@hillaryclinton.com
mastrie@gmmb.com
matt.mckenna@gmail.com
matt.wing@changetowin.org
matt@sb-atalaya.co
matt@sb-atalaya.com
maura.pally@gmail.com
maxtell@princeton.edu
maygers@huffingtonpost.com
mbarnes@barackobama.com
mbell@bsgco.com
mberger@bergersingerman.com
mberman@dubersteingroup.com
mbership@aipac.org
mbronfein@gmail.com
mcantrell@hillaryclinton.com
mcgowan@podestagroup.com
mcintire@nytimes.com
mdaley@hillaryclinton.com
mdeangelis@albrightstonebridge.com
mdillon@clifbar.com
mdover@hillaryclinton.com
mdunkelman@clintonfoundation.org
me_ndi+unsubscribe@ndi.org
me_ndi@ndi.org
mecof05@hotmail.com
media@americanprogressaction.org
mediarelations@law.georgetown.ed
mediarelations@law.georgetown.edu
melgincossart@americanprogress.org
melias@perkinscoie.com
melindarwarner@gmail.com
membership@aipac.org
mep@wilsoncenter.org
merrill@hrcoffice.com
merson@gmail.com
messenger@truthout.org
mfeldmanpiltch@americansecurityproject.org
mfeldstein@harvard.edu
mfisher@hillaryclinton.co
mfisher@hillaryclinton.com
mfox@glaserfoundation.org
mg7nocyrww58nk-9a@mail.gmail.com
mgitenstein@mayerbrown.com
mhalle@hillaryclinton.com
mhansen@consumer.org
mharris@hillaryclinton.com
mhart@americanprogress.org
mheinbaugh@pmidpi.com
mhuegel@hillaryclinton.com
michael.p.falcone@abc.com
michael@huttner.org
michael@progressnowaction.org
michael@progressnoweducation.org
michaelbuckeye24@gmail.com
michaelfromanustr@gmail.com
micheleflournoy3@gmail.com
michpatron@gmail.com
mieri@gmail.com
mieri@hillaryclinton.com
mike.froman@ptt.gov
mike.manatos@manatos.com
mike08082013@gmail.com
mike@keystoneprogress.org
mike_palamuso@lcv.org
mikef@turnerfoundation.org
mileageplus_noreply@united.com
mileageplus_partner@news.united.com
miles-deborah@sbcglobal.net
milia.fisher@gmail.com
miller.jr@gmail.com
mills@gmail.com
millscd@state.gov
milton@toledojunior.com.br
min@thecommongood.net
mindyk@brookings.edu
miriam@tikkun.org
mitchell@glaserprogress.org
mkstenzel@gmail.com
mlettre@verizon.net
mlippert@barackobama.com
mmarshall@hillaryclinton.co
mmarshall@hillaryclinton.com
mmcauliffe.hrco@gmail.com
mmcauliffe@hrcoffice.co
mmcauliffe@hrcoffice.com
mmccloud@dmggroup.com
mmorell@beaconglobalstrategies.com
mnichols5@gmail.com
molly.beth.wilder@gmail.com
mona@algpolling.com
mond1967@015.net.il
mond1967@inter.net.il
mond1967@zahav.net.il
monizej@hq.doe.gov
mook2015@gmail.com
mortega@hillaryclinton.com
mos@sandlerfoundation.org
mp@fwwatch.org
mpally@clintonfoundation.org
mpaul@hillaryclinton.com
mpolachek@americanprogress.org
mro_jkbp0myhw@mail.gmail.com
ms@hillaryclinton.com
mschlosberg@fwwatch.org
mschmidt@hillaryclinton.com
mshapiro@hillaryclinton.com
msligh@rafiusa.org
msmith@hillaryclinton.com
msmorodsky@smorodsky.onmicrosoft.com
msmorodsky@uaba.org
mstadtler@apcoworldwide.com
msutphen@stonebridge-international.com
mthatcher@hillaryclinton.com
mtiq131tma@mail.gmail.com
munshisherally@gmail.com
mvlacich@hillaryclinton.com
mwerz@americanprogress.org
mwhelan@nsnetwork.org
mwhite@hillaryclinton.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.13720.16156.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.13749.16189.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.14630.16745.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.14630.16746.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.14901.16950.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.15022.17169.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.15022.17170.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.15484.17726.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.15899.18035.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.16065.18178.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.16065.18179.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.16157.18237.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.16759.18717.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.17268.19211.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.7619.9946.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.7619.9947.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.7874.10250.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.7874.10251.7@unsub-sj.mktomail.com
my2g45rxljjvgv3sjqzuy22norzdontvgzat2pi.9161.12066.7@unsub-sj.mktomail.com
myroslaw@smorodsky.com
n.esterhay@gmmb.com
n.murphy@nytimes.com
n.podesta@gmail.com
n.rimel@gmmb.com
n6jxuu169ejtolowk5dg@mail.gmail.com
n8rs-lna730+yk9bdq@mail.gmail.com
n@alumni.stanford.edu
n@bsgco.com
n@ceip.org
n@gmail.com
n@hillaryclinton.com
n@nsnetwork.com
n@pmj-dc.com
n@progressiveaccountability.org
na@algpolling.com
nadia.nowytski@aporter.com
nakschake@gmail.com
nancybk@aol.com
nancyrr@nancyroteringforcongress.com
nas@hillaryclinton.com
nasredeen.abdulbari@post.harvard.edu
natalie@tikkun.org
nationalpress2016+unsubscribe@hillaryclinton.com
natos@manatos.com
nayak@hillaryclinton.com
nbaer@hillaryclinton.com
nberger@hillaryclinton.com
nberning@foe.org
nbraumann@acus.org
nbudzinski@hillaryclinton.co
nbudzinski@hillaryclinton.com
ncom@aol.com
ncunningham@maglobal.com
nda@hillaryclinton.com
nde_2260653712.4@informz.net
nde_2298022412.4@informz.net
nde_2698216539.4@informz.net
nde_2715703239.4@informz.net
nde_2774942008.4@informz.net
ndi@ndi.org
ne@xeolux.com
neelima.maheshwari@witnesslive.in
negzfbyfr4undwrbvehd6d
-semndv3w@mail.gmail.com
nehand5@aol.com
nenson@bsgco.com
news@thehill.com
newuser@asc.upe
newuser@asc.upen
newuser@asc.upenn.edu
nfo@americansecurityproject.org
nfo@forwardengagement.org
ng@ricehadleygates.com
ng_dlk7gq@mail.gmail.com
nh@dnc.org
nharvey@doctorsoftheworld.org.uk
nhbowen@gmail.com
nhstaff@hillaryclinton.com
niatis@gmail.com
nica.pollock@dlapiper.com
nick.s.merrill@gmail.com
nico.pitney@gmail.com
nifer.m.palmieri@gmail.com
nmerrill.hrco@gmail.com
nmerrill@hillaryclinton.co
nmerrill@hillaryclinton.com
nmerrill@hrcoffice.co
nmerrill@hrcoffice.com
nmounier@kirvindoak.com
nn@gmail.com
nnayak@hillaryclinton.com
nnielsen@americanprogressaction.org
nnifer.m.palmieri@gmail.com
nnymayfield@stanford.edu
nochuck@aol.com
nolds@gpg.com
nondiak@americanprogress.org
noreply+feedproxy@google.com
noreply@google.com
noreply@progressohio.org
normapercy@aol.com
notice-reply-6kk3b5r9j7w6jkw@ga-mail.action.lcv.org
notice-reply-x7wi3ne49jektwbi@ga3.org
notice-return-6kk3b5r9j7w6jkw@ga-mail.action.lcv.org
notice-return-x7wi3ne49jektwbi@ga3.org
noveck@gmail.com
nr4rf6a@mail.gmail.com
nrobinson@hillaryclinton.com
nsachs@outlook.com
nsoderberg@comcast.net
nson@bsgco.com
nsubscribe@googlegroups.com
ntrell@hillaryclinton.com
nyt_unsubscribe@lga2.nytimes.com
nytdirect@nytimes.com
o13bb.4p1ap.c8obu0@e2ma.net
o9q@mail.gmail.com
o@gmail.com
o@gmmb.com
o@hrcoffice.com
o@progressivemediausa.org
o_0kng@mail.gmail.com
o_r8zk_u6um-oxyrb+yqjw@mail.gmail.com
oaflnmksh6utqhojpq@mail.gmail.com
obbymook2015@gmail.com
odesta@gmail.com
odesta@law.georgetown.edu
odesta@podesta.com
oezxmzbsd@blackindians.com
of1795f3b0.77ef5bb8-on85257482.006913c8-85257482.0068ddbe@sierraclub.org
of30ca9632.c7f86c2e-on8525746b.0052efe0-8525746b.0052efe4@sierraclub.org
of63505937.268a9bfd-on8525749c.00562de6-8525749c.0055dc40@sierraclub.org
of65b97a98.4ec5712c-on00257f62.0076d57c-1456263602799@notes.na.collabserv.com
of660f43c9.06728ff8-on85257490.004da6e3-85257490.004d6b13@sierraclub.org
of6f256fa2.e11af508-on8525746a.00764a2e-8525746a.00764a31@sierraclub.org
of6f8e9319.d3eae62d-on8525746b.00770a4d-8525746b.00770a52@sierraclub.org
of7140ec0b.c3106d61-on8525749d.007234db-8525749d.0071c9d2@sierraclub.org
of86697239.8900b246-on8525746e.00475989-8525746e.0046fa5d@sierraclub.org
ofbe9e92bc.1fcae060-on85257443.00695afb-85257443.00690118@sierraclub.org
ofd8708406.aa43ebc4-on85257444.0065752e-85257444.006528ee@sierraclub.org
off4755792.5fef841b-on8525747f.0077f94f-8525747f.00779933@sierraclub.org
ofliegelman@hfaintern.com
ogress@americanprogress.org
ohn.podesta@gmail.com
ohn@algpolling.com
ohn@nutiva.com
ohrt5l6a1sancm4mjoqojfww@mail.gmail.com
ois@progressivemediausa.org
ok2015@gmail.com
ol53@cornell.edu
olb4vt@virginia.edu
olds@hillaryclinton.com
olis@gmmb.com
olly@bsgco.com
olow@hillaryclinton.com
olyn_wu@asia.apple.com
om@aol.com
omaha@genius-network.com
on@americanprogress.org
on@bsgco.com
on@gmail.com
on@hillaryclinton.com
one@podesta.com
onnolly@bsgco.com
onqfjw@mail.gmail.com
oo2y_-j6_+qvy5vblfecl5+fz8atm1wqbhfw@mail.gmail.com
ook.littman@gmail.com
ook2015@gmail.com
ooz92zpgu7utuhtgdahjfwevl_lxn4xko833fn_p0nhw@mail.gmail.com
oped@nytimes.com
opher.miller@benjerry.com
opinion@unionleader.com
opnepaxfheewyypvdkjgzlxekphq1ew@mail.gmail.com
or@centerforfoodsafety.org
or@icloud.com
oracao2@aol.com
oran@consumer.org
orca100@upcmail.nl
orencshur@gmail.com
org@bounces.salsalabs.net
originaluser@asc.upenn.edu
orj+csiwk_ckusztw@mail.gmail.com
orn@gmmb.com
osberg@fwwatch.org
osenberger@hillaryclinton.com
oshschwerin@gmail.com
oshur@hillaryclinton.co
oshur@hillaryclinton.com
oso@georgetown.edu
oster.brent@ymail.com
ote@jenniferpae.com
otmtvq-kpvlrf8_rh7-h8b6rg75ufter2dq@mail.gmail.com
oton1c0w@mail.gmail.com
otte27bzm_5zndamqmhwhpstrtpsztflg@mail.gmail.com
ournoy11@gmail.com
outreach@ceq.eop.gov
ov@myflorida.com
owenstein@hillaryclinton.com
oxm96jvepk+9a@mail.gmail.com
p0+8kby7kcsjw@mail.gmail.com
p@law.georgetown.edu
pa-everyone@podesta.com
pa@mail.gmail.com
paigeme@mac.com
palmieri@gmail.com
palmieri@hillaryclinton.com
pasha@gmail.com
pat_nobbie@rockefeller.senate.gov
patriciaduff@thecommongood.net
patrick.glen@usdoj.gov
paul.schiefer@amys.co
paul.schiefer@amys.com
paulschiefer@amyskitchen.net
pbarnett@sb-atalaya.com
pbarry122@gmail.com
pbegala@hatcreekent.com
pbrigham@maglobal.com
pbrodnitz@bsgco.com
pdallison@politico.eu
peechdrafts@hillaryclinton.com
peter.emerson@me.co
peter.emerson@me.com
peteremerson@gmail.com
petition@kirkpatrickforarizona.com
petkanas@hillaryclinton.com
pgriffin@gmu.edu
pgriffin@pmj-dc.com
philip.gordon@verizon.net
philsbarnett@gmail.com
physiodc@gmail.com
piercekl@law.georgetown.edu
pir@hrcoffice.co
pir@hrcoffice.com
plarry@labelgmos.org
pmq+-cu4980e2fagkgvvm6aujfw@mail.gmail.com
podesta.mary@gmail.com
podesta@georgetown.edu
podesta@gmail.com
podesta@heatherpodesta.com
podesta@ici.org
podesta@law.georg
podesta@law.georgetown.edu
podesta@podesta.com
pogden@americanprogress.org
policynews@earth-policy.org
politicalunit@abcnews.go.com
politicalunit@abcnewsnow.com
politicoemail@politicopro.com
powerpost@washpost.com
pp@gmail.com
ppionline.org@mail.salsalabs.net
pr@thinkprogress.org
preines.hrco@gmail.com
presidente@larosa-foundation.com
press@broadfoundation.org
press@clintonfoundation.org
press@gmfus.org
press@hillaryclinton.com
press@jeb2016.com
press_office@clinton.senate.gov
progden@gmail.com
progress@americanprogress.org
progress@americanprogressaction.org
progress@mx3.americanprogressaction.org
prosen@clintonfoundation.or
prosen@clintonfoundation.org
proservices@politicopro.com
prouse@barackobama.com
prouse@perkinscoie.com
prucc3og@mail.gmail.com
ps@hillaryclinton.com
pschiliro@barackobama.com
pschiliro@sb-atalaya.com
pschwartz@cleanwater.org
pslutsky@progressivestrategies.net
ptbdao-vyigorzg@mail.gmail.com
ptowers@panna.org
public@nytimes.com
pverveer@aol.com
q-_has0vq@mail.gmail.com
q3lwk2khowwrcrg@mail.gmail.com
q6rmaa@mail.gmail.com
q7edyew@mail.gmail.com
q@mail.gmail.com
qfvvonrop9yryfitjtpdvojm+0zfq@mail.gmail.com
qjdbj36jask5n4pf+fflct577aygg@mail.gmail.com
qjhbqaprzxq@mail.gmail.com
qjnqlu07jzrhg@mail.gmail.com
qjnthzrz0ehgarhmv2munb724pbscgxrf+k1rpw@mail.gmail.com
qlnb-ztwzunvbp2x21ifix1iptkq@mail.gmail.com
qmypz10pr_2d1vp0nj8a@mail.gmail.com
qo_32ojdwhp8k_pg@mail.gmail.com
qoo57tjrckzwlpbuhp0nswbrlys19ogogdtexbmpqxew@mail.gmail.com
qpet0+rsdchhn3mzdwd2yu-ig7_jmgeopp8nhg@mail.gmail.com
qpw@mail.gmail.com
qqdbycd2bc4bmjrtc8kbkb_q@mail.gmail.com
qrhaaqtycwdmaos1gxam58ds6tg@mail.gmail.com
qvenut4yk_19h6gbtkb0-crkww@mail.gmail.com
qvpczts5fdam5lixueqska@mail.gmail.com
qwnjtb+kjeakmev7mgpq@mail.gmail.com
qy-ad6+v+vuw@mail.gmail.com
qzw@mail.gmail.com
r.m.palmieri@gmail.com
r.noble@interpol.int
r0+vgwmdztg4pk8hg7fknq-2m7d+ipvvht8vqpc9swxw@mail.gmail.com
r29@hrcoffice.com
r@gmail.com
r@hillaryclinton.com
r@icloud.com
r@sandlerreiff.com
r@thinkprogress.org
ra357@law.georgetown.edu
ra@gmail.com
ra@progressiveaccountability.org
rabbilerner.tikkun@gmail.com
rabbilerner@tikkun.org
rachel.c.reid@gmail.co
rachel.c.reid@gmail.com
rand1142@verizon.net
rapid+unsubscribe@googlegroups.com
rapidresponse@barackobama.com
rargenta@aol.com
rbarnes@afscme.org
rbarnett@wc.com
rbuckwalterpoza@progressivemediausa.org
rchalif@hillaryclinton.com
rche@democracyalliance.org
rcher@foe.org
rcizik@aol.com
rco@gmail.com
rcohen@iht.com
rcrr+unsubscribe@hillaryclinton.com
rdeleon@americanprogress.org
rdetchon@unfoundation.org
rdouglas@pascla.org
rduncan@progressivemediausa.org
re47@hillaryclinton.co
re47@hillaryclinton.com
re@nytimes.com
rebecca.ballhaus@wsj.com
rebecca@progressiveaccountability.org
rebeen.pasha@gmail.com
recommendations@ptt.gov
regan@law.georgetown.edu
replies@actblue.com
reply-f3b12fa708-08a29c1973-ea81@u.cts.vresp.com
reply-ff2a11787067-60_html-4189601-7204487-50@mail.nb
reply-ff2a11787067-60_html-4189601-7204487-50@mail.nbcnews.com
reply-ff2b15727c6c-20_html-2481184-7208679-4961@morning7.theskimm.com
reply-ff2b1579776c-20_html-2481184-7208679-4106@morning7.theskimm.com
reply-ff3015717d61-20_html-2481184-7208679-4961@morning7.theskimm.com
reply-ff3315717d66-20_html-2481184-7208679-4962@morning7.theskimm.com
reply-ff3415717763-20_html-2481184-7208679-4949@morning7.theskimm.com
reply-ff3715717562-20_html-2481184-7208679-4949@morning7.theskimm.com
reply-ff5e137473-20_html-2481184-7208679-4953@morning7.theskimm.com
reply-ff6112707d-20_html-2481184-7208679-4952@morning7.theskimm.com
reply-ff611d7276-20_html-2481184-7208679-4951@morning7.theskimm.com
reply-ff65127071-20_html-2481184-7208679-4952@morning7.theskimm.com
reply-ff65137274-20_html-2481184-7208679-4953@morning7.theskimm.com
reply-ff66127375-20_html-2481184-7208679-4954@morning7.theskimm.com
reply-ff67127077-20_html-2481184-7208679-4952@morning7.theskimm.com
reply-ff67127275-20_html-2481184-7208679-4951@morning7.theskimm.com
reply-ff69127075-20_html-2481184-7208679-4952@morning7.theskimm.com
reply-requested@kirkpatrickforarizona.com
res-noreply@google.com
researchalliance2008@googlegroups.com
retirees@knox.edu
rews@jacompany.com
reynolds@hillaryclinton.com
rfeinberg@ucsd.edu
rg@nsnetwork.org
rgolis@gmmb.com
rgq7zayht7rvea@mail.gmail.com
rgun@alumni.stanford.edu
rguson@hillaryclinton.com
rhamilton@vestarden.com
rhh+6k8amh9yd9qyxoavrxiw@mail.gmail.com
rholt@aaas.org
ri@hillaryclinton.com
ria@hillaryclinton.com
ribe@hillaryclinton.com
ricesusane@aol.com
ricesusane@srs.bis.na.blackberry.com
rich@dixondavismedia.co
rich@dixondavismedia.com
rich@hillaryclinton.com
richizquierdo@gmail.com
riegel@hillaryclinton.com
riginaluser@asc.upenn.edu
rill@hillaryclinton.com
rill@hrcoffice.com
rin@gmail.com
rin@hillaryclinton.com
rin@hrcoffice.com
rissa.astor@icloud.com
ristinakschake@gmail.com
riti+unsubscribe@knox.edu
rjk@earthpolicy.org
rjkessler@verizon.net
rk@hillaryclinton.com
rkas@aol.com
rls@foe.org
rmalley555@gmail.com
rmarshall@cardiocarellc.com
rmckay@mckayfund.org
rmd8@law.georgetown.edu
rmowen@virginia.edu
rneumann@academyofdiplomacy.org
robbymook2015@gmail.co
robbymook2015@gmail.com
robbymook@gmail.com
robg@real.com
rol.schweizer@wholefoods.com
ron.klain@revolution.com
ronnie@organicconsumers.or
ronnie@organicconsumers.org
rosa-foundation@pec.it
rothk@hrw.org
rothstei@law.georgetown.edu
roy.sekoff@gmail.com
roy.spence@gsdm.com
rr@hillaryclinton.com
rreed@newsadvance.com
rrie@bsgco.com
rrill@hrcoffice.com
rrk@hillaryclinton.com
rrn@vnf.com
rsb81@law.georgetown.edu
rscottlilly@hotmail.com
rshall@hillaryclinton.com
rshberg@stonyfield.com
rsmith@cleanwater.org
rson@nea.org
rspector@centerforfoodsafety.org
rstdraft@nytimes.com
rsuh@nrdc.org
rsvcrj3rtvck0n_xa@mail.gmail.com
rsvp@skadden.com
rtigan@saban.com
ruth.bell@wilsoncenter.org
ruthgoldway@gmail.com
ruthgreenspanbell@gmail.com
rverma@steptoe.com
rw@mail.gmail.com
rweiss@americanprogress.org
ry@thebigtv.com
ry@usrtk.org
ryan@campaigntodefendamerica.org
ryan@progressiveaccountability.org
ryaneanderson@gmail.com
ryl.mills@gmail.com
ryn.sepp@gmail.com
s-2rtk1p8jr7lywrvjrh0di1zh1la2j47tzky62tl6yquyapuy91i8ljjq@bounce.linkedin.com
s5@gmail.com
s@cdmillsgroup.com
s@gmail.com
s@gmmb.com
s@hillaryclinton.com
s@naturespath.com
s@organicconsumers.org
s@panna.org
s@progressiveaccountability.org
s@sandlerfoundation.org
s@wsj.com
sabri.oncu@gmail.com
sajones@kslaw.com
salexander@fwwatch.org
sandler@sandlerreiff.com
sara.latham@ptt.gov
sara@progressiveaccountability.or
sara@progressiveaccountability.org
sarah@democracyinamericas.ccsend.com
sarah@democracyinamericas.or
sarah@democracyinamericas.org
sarah_gegenheimer@clinton.senate.gov
sarahelizabethfeinberg@gmail.com
saramlatham@gmail.com
sba@mail.gmail.com
sbay@hillaryclinton.co
sbay@hillaryclinton.com
sbay@hrcoffice.com
sberger@albrightstonebridge.com
sberger@stonebridge-international.com
sblackledge@pirg.or
sblackledge@pirg.org
sbrown@politico.eu
schake@gmail.com
schake@hillaryclinton.com
schiefer@amyskitchen.net
schultz@who.eop.gov
schweiger@pennfuture.org
schwerin@hillaryclinton.com
schwerin@hrcoffice.com
scott.nathan@gmail.com
scribe@hillaryclinton.com
scurran@clintonfoundation.or
scurran@clintonfoundation.org
scurrie@bsgco.com
scutter@barackobama.com
sdaetz@sandlerfoundation.org
sdefife@outlook.com
sdefife@restaurant.org
sdubois@progressivemediausa.or
sdubois@progressivemediausa.org
se0g@mail.gmail.com
se@jesseferguson.com
seidman@law.georgetown.edu
seizenstat@cov.co
seizenstat@cov.com
seizenstat@gmail.com
sendingthrough@nationbuilder.com
sepp@equitablegrowth.org
service@paypal.com
ses@sandlerfoundation.org
sewallconroy@comcast.net
sey@hillaryclinton.com
sfaber@ewg.org
sg@mail.gmail.com
sgeorge@albrightstonebridge.com
sgodwin3@googlemail.com
sgreenberg@gqrr.com
sh@gmail.com
shaikley@clintonfoundation.org
shanatabak@gmail.com
sher@hillaryclinton.com
sherry.licari@level3.com
shine@earthlink.net
shschwerin@gmail.com
shul@tikkun.org
shulmanh@dnc.org
shur@dga.net
shur@hillaryclinton.com
sidney.blumenthal@gmail.com
sierra.news@sierraclub.org
silaslee@silaslee.net
singletarym@washpost.com
skaddenarpsetal@skadden.com
ski@hillaryclinton.com
skimmthis@theskimm.com
sknaebel@sandlerfoundation.org
skoff@plaind.com
sky@progressivemediausa.org
slatham@hillaryclinton.co
slatham@hillaryclinton.com
slilly@americanprogress.org
smarx@hillaryclinton.com
smcclain@hillaryclinton.com
smith@eq-cap.com
sn1pr05mb1934e2d50ee66a1a8e2dfeafc2a00@sn1pr05mb1934.namprd05.prod.outlook.com
sn1pr0701mb1789f62365328c55530799b593b60@sn1pr0701mb1789.namprd07.prod.outlook.com
sn1pr0701mb1982a3b52a886ecac4956af2d9680@sn1pr0701mb1982.namprd07.prod.outlook.com
sn1pr07mb2288e64ecef4269d460bbff193b40@sn1pr07mb2288.namprd07.prod.outlook.com
sn2pr0701mb7330f0f9b7921e67a424b84935a0@sn2pr0701mb733.namprd07.prod.outlook.com
sn2pr11mb0016371961bd873ad24d4332ba9b0@sn2pr11mb0016.namprd11.prod.outlook.com
sn2pr11mb00167a5805aeed23c1a33b5fba9b0@sn2pr11mb0016.namprd11.prod.outlook.com
snt150-w75f932a59b6a19648914e9c31d0@phx.gbl
snt153-w23dfba4fffbb83eb30c79fa8b60@phx.gbl
snt153-w428bc911e18ad38b8d7adea8b40@phx.gbl
snt153-w573677dda7c63d547377d9a8b60@phx.gbl
snt404-eas154d33d4ef2cc3bef19ca33dfed0@phx.gbl
snt404-eas16002e1e8da9cf1a4394b15dfef0@phx.gbl
snt404-eas1719f2b389b1e41d0a62887dfc30@phx.gbl
snt404-eas222810dfbcd735019b2c3d7dfd00@phx.gbl
snt404-eas2676d2d69d886934b6f3d0edfd80@phx.gbl
snt404-eas2855212fa65c48a217cdad9df160@phx.gbl
snt404-eas32223d39b39abe008831fe0dfdd0@phx.gbl
snt404-eas400dd6319f54a518ddf10cadfe00@phx.gbl
snt404-eas405928e8421decf05049847dfec0@phx.gbl
snt404-eas407e40cbe5695577bfe262edf6d0@phx.gbl
snt404-eas9392baa7a6c34bcf981c79df120@phx.gbl
son@bsgco.com
son@hillaryclinton.com
sonalshah@google.com
soozshin@gmail.com
sorel@sergei-orel.com
spaduano@hfaintern.com
spc58@georgetown.edu
speechbook@hillaryclinton.co
speechbook@hillaryclinton.com
speechdrafts+bncbcilxjosumerbbphwwzqkgqe2eby6va@hillaryclinton.com
speechdrafts+bncbcilxjosumerbnfow6zakgqeu2pdp7a@hillaryclinton.com
speechdrafts+bncbcrivk5juebbbcwvvk2akgqe74anviy@hillaryclinton.com
speechdrafts+bncbdk7tvwg6enbbx5ow6zakgqeo2g3wwa@hillaryclinton.com
speechdrafts+help@hillaryclinton.com
speechdrafts+owners@hillaryclinton.com
speechdrafts@hillaryclinton.com
srademaker@podestagroup.onmicrosoft.com
sricchetti@cox.net
ss735@georgetown.edu
sshmuely@mit.edu
ssmith@usip.org
ssolow@hillaryclinton.com
sstahl@cdrnys.org
sstreett@clintonfoundation.org
ssymms@prdands.com
sta@gmail.com
sta@law.georgetown.edu
stacieorell@gmail.com
stacy@safecosmetics.or
stacy@safecosmetics.org
stalbott@brookings.edu
star-yellow-sml@2x.png
stat@cov.com
stat@gmail.com
staylor2050@gmail.com
stephanietatar@gmail.com
stephen.hull@huffingtonpost.com
stephen@winwithoutwar.org
stephenjhadley@mac.com
stephenjhadley@me.com
sterhay@gmmb.com
steve.crider@amys.com
steve@powerpac.org
stevecrider@amyskitchen.net
stever@mercola.com
stevesilberstein@hotmail.com
stinakschake@gmail.com
stolitzka.anna@gmail.com
stor@icloud.com
stormtrackers@googlegroups.com
str@gmail.com
stuart@huffingtonpost.com
subscribe@hillaryclinton.com
sue.horton@latimes.com
sullivan@gmail.com
sullivan@hillaryclinton.com
summitinfo@navajobusiness.com
susan@eisenhowergroup.com
susan@messageinc.com
susan@one.org
suzygeorge8@gmail.com
sweaver@aci-na.org
syr.edu@mail152.suw16.rsgsv.net
syr.edu@mail25.suw17.mcsv.net
t.barrabi@ibtimes.com
t.mckenna@gmail.com
t.w.drakex@gmail.com
t4zgpov7nhkaht3m-ht7jrrydkq@mail.gmail.com
t8abe1e8e4eac1b0a205c0@smtp2.interpol.int
ta@gmail.com
taitsye@gmail.com
tamott@knox.edu
tar-yellow-sml@2x.png
tara.mcguinness@gmail.com
tara@iraqcampaign.org
tara@progressiveaccountability.org
taracook.littman@gmail.com
tat@cov.com
tblinken@barackobama.com
tblunt@hillaryclinton.com
tbrody@hillaryclinton.com
tbudak@gmfus.org
tcarrk@hillaryclinton.com
tcgwdub7xvaryj1ikrpybxyjfjwq@mail.gmail.com
tcuellar@stanford.edu
tdonilon@gmail.com
tdowney@dmggroup.com
teamrotering@nancyroteringforcongress.com
tech@americanprogress.org
teddy.goff@gmail.co
teddy.goff@gmail.com
teddy@precisionstrategies.com
tedkaufman@comcast.net
tein@hillaryclinton.com
ter@hks.harvard.edu
tern@gmfus.org
terribillionairs@aol.com
terson@hillaryclinton.com
tessier@podestagroup.onmicrosoft.com
tevecrider@amyskitchen.net
tflourno@aft.org
tflournoy11@gmail.com
tgayle@hillaryclinton.com
tghouser.hrc@gmail.co
tghouser.hrc@gmail.com
tgoff@hillaryclinton.com
tham@hillaryclinton.com
than@gmail.com
the.secretary@hq.doe.gov
thecommongood.net@mail141.wdc01.mcdlv.net
thecommongood.net@mail151.atl171.mcdlv.net
thecommongood.net@mail168.atl101.mcdlv.net
thecommongood.net@mail170.atl171.mcdlv.net
thecommongood.net@mail171.wdc02.mcdlv.net
thecommongood.net@mail182.atl101.mcdlv.net
thecommongood.net@mail187.atl101.mcdlv.net
thecommongood.net@mail199.atl101.mcdlv.net
thecommongood.net@mail211.suw14.mcdlv.net
thecommongood.net@mail215.atl61.mcsv.net
thecommongood.net@mail22.us4.mcsv.net
thecommongood.net@mail23.us4.mcsv.net
thecommongood.net@mail34.atl91.mcsv.net
thecommongood.net@mail39.atl31.mcdlv.net
thecommongood.net@mail39.atl71.mcdlv.net
thecommongood.net@mail40.atl111.rsgsv.net
thecommongood.net@mail44.atl111.rsgsv.net
thecommongood.net@mail46.atl11.rsgsv.net
thecommongood.net@mail55.atl111.rsgsv.net
thecommongood.net@mail56.atl51.rsgsv.net
thecommongood.net@mail6.us4.mcsv.net
thecommongood.net@mail72.suw15.mcsv.net
thecommongood.net@mail8.atl31.mcdlv.net
theditor@townhallmail.com
theskimm.com@morning1.theskimm.com
theskimm.com@morning2.theskimm.com
thogan@hillaryclinton.com
thomas_f._vietor@who.eop.gov
ticoemail@politicopro.com
tikkun.org@mail.salsalabs.net
tilrc@tilrc.org
tim_mulvey@clinton.senate.gov
timmons@equitablegrowth.org
tina@presidentclinton.co
tina@presidentclinton.com
tinakschake@gmail.com
tjroemer@gmail.co
tjroemer@gmail.com
tjtrimpa@hhlaw.com
tkanas@hillaryclinton.com
tlee@aflcio.org
tlovejoy@unfoundation.org
tmagady@elderlaw.net
tmarvin@consumer.org
tmatzzie@gmail.com
tmcguinness@americanprogress.org
tmcguinness@progressivemediausa.org
tmcnukv58iqle-rbqjjwybvz3qm1osfatd-lkeg@mail.gmail.com
tmd@georgetown.edu
tmsreprints@permissionsgroup.com
todd.stern@wilmerhale.com
tom.daschle@dlapiper.com
tom.nides@morganstanley.com
tom@daschlegroup.com
tom@zzranch.com
tom@zzranch.org
tommy_ross@reid.senate
tommy_ross@reid.senate.gov
tonigverstandig@aol.com
tonigverstandig@gmail.com
tony.carrk@gmail.com
tony@bhstrategiesllc.com
tony@thearcca.org
tonybenton@hotmail.co.uk
toptalkers+bncbcmzle4zqycbbqmzsc2qkgqezykugfq@hillaryclinton.com
toptalkers+help@hillaryclinton.com
toptalkers+owners@hillaryclinton.com
toptalkers@hillaryclinton.com
tor@icloud.com
torybrown@gmail.com
tpodesta@podesta.com
tpschmidt@gmail.com
tqwqkeo+hx+8j5o1t_faekzq@mail.gmail.com
trossjr@gmail.com
trustees-user+bncbcc554ou2igrb7xjqgqqkgqeb22irfa@knox.edu
trustees-user+help@knox.edu
trustees-user+owners@knox.edu
trustees-user+unsubscribe@knox.edu
trustees-user@knox.edu
trustees@knox.edu
trusteesemeriti+bncbcc554ou2igrbaf52w2akgqeqpmuspq@knox.edu
trusteesemeriti+help@knox.edu
trusteesemeriti+owners@knox.edu
trusteesemeriti+unsubscribe@knox.edu
trusteesemeriti@knox.edu
truthout.org@mail.salsalabs.net
tryhweycw@mail.gmail.com
tseco@indiagov.org
tsheridan@clintonfoundation.org
tsonenshine@earthlink.net
tsteyer@fahrllc.com
tvxx1tmfa7wtssdz5we0nd2kry2qlutbt5vjnhyeg@mail.gmail.com
twaddelow@albrightstonebridge.com
twbxa@mail.gmail.com
twirth@unfoundation.org
twittes@brookings.edu
tyler.kingkade@huffingtonpost.com
tz@bsgco.com
tz@who.eop.gov
tzzq@mail.gmail.com
ub03-000027ab019e465700357a5dd9be6039e20832cfd7725acfc9a42eee@genius-network.com
ub03-000027ab019e46570036020325140a2ee4de5154f615fb8ffb051480@genius-network.com
ubois@progressivemediausa.org
ubscribe@e-elgar.com
uc5h1fsq5m9czz0denmonawm+hkio-p3q@mail.gmail.com
ucy_6ttauuvupf7xox53rbhaoatw1ss668ydgw@mail.gmail.com
udbrgja@mail.gmail.com
uebwfc+tu1my2mha1obyd88yb+erq8rag@mail.gmail.com
uerr2vtoly9fzx6v3yu7-4zjyaqg@mail.gmail.com
uf1m+z56qhdbpmr3lkfojb1rt0kb4w@mail.gmail.com
ugnroijo-2aa@mail.gmail.com
uhlwpwgww@mail.gmail.com
ukr8p49rlgkvtxcok_diiwpb-dsa@mail.gmail.com
ul@hillaryclinton.com
ullivan@gmail.com
ullivan@hillaryclinton.com
uma@clintonfoundation.org
uma@hrcoffice.com
unalakiset@gmail.com
uncom@aol.com
united.5765@envfrm.rsys2.com
unsub-asykytpkpdbndspptknzmcwyzztmyzyymdwvpplppylwssdcgmt@townhallmail.com
unsub-blzljcqlqfdyjdlpgfykpntjkkcpjkjjpftsqqzqqjztbbfnmpc@townhallmail.com
unsub-epzstzhshydfyqypqrflrcktllzrtlttrykvhhqhhtqkppycwrz@townhallmail.com
unsub-gtcykltytgwdgnlntgdqcfhkqqlckqkkcghjttmttkmhnngfpcl@townhallmail.com
unsub-hfmqshwqwbnzsnnfwhzrvdgsrrhvsrssvbglwwfwwsfgmmbdpvh@townhallmail.com
unsub-naral-533-2261225._cqfkxx@fbl.actionkit.com
unsub-naral-676-2261225.0kjeezx@fbl.actionkit.com
unsub-omtzkrlzljfdkfkwlldgtpvkggrtkgkktjvcllqllkqvmmjpntr@townhallmail.com
unsub-pnoh-692-522478.kgqlwgx@fbl.actionkit.com
unsub-pylqyclqljfbjvqlqqbthgsyttchytyyhjsrllvllyvsddjgkhc@townhallmail.com
unsub-tpvzbmczchwkhcmvzzkfltgbffmlbfbblhgdccpccbpgjjhtrlm@townhallmail.com
unsub-xgjvpjbvbhgthbspjjtldymplljdplppdhmnbbcbbpcmsshyqdj@townhallmail.com
unsubscribe-232a4a45176fccacab865e520-173480a79e-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-1c8a1277c6-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-2987a4f78a-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-4c785b3b00-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-5b57baca61-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-5c0dd2e955-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-69277c9eb7-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-7222bf8e29-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-79a29582e2-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-85e1f733d4-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-94feb40a35-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-b01bd9be49-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-c4d27aca85-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-c7749cd2f3-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-ccce1cde02-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-d38c6f9d5e-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-d9d42092c2-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-dfe7349e53-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-eac8141f66-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-f9c43fdfb8-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-232a4a45176fccacab865e520-fc479a890a-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-dkuutlk2otlyhykh2i-7cfda08b@cmail20.com
unsubscribe-drtrtuy2xdtludjy2i-795eb942@cmail20.com
unsubscribe-f3d3fd27bd777757fa518a219-f2cca6a17e-56ea256efc@mailin1.us2.mcsv.net
unsubscribe-ijkdlty2otlyhykh2i-7cfda08b@cmail20.com
unsubscribe-iykrtrt2xdtludjy2i-795eb942@cmail19.com
unsubscribe-jhlduul2xdtludjy2i-795eb942@cmail1.com
unsubscribe-jkhjtty2otlyhykh2i-7cfda08b@cmail1.com
unsubscribe-jtdhad2xdtludjy2i-795eb942@cmail1.com
unsubscribe-jtkyjrl2otlyhykh2i-7cfda08b@cmail2.com
unsubscribe-jttknl2otlyhykh2i-7cfda08b@cmail1.com
unsubscribe-jyurljk2xdtludjy2i-795eb942@cmail19.com
unsubscribe-mc.us11_13d0c4ee04919a2127f6c5960.a9b8ce92b2-30c8959f18@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.01271aebe2-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.11b36733f5-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.1738d500ff-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.1f1dcdbb47-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.23c491d313-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.3890833092-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.397d4c0cb2-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.3e830c12cd-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.43d1080137-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.4434c5bb22-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.60fd9469ff-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.660629ec67-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.963cdd77b4-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.9664baa170-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.a6b5609c44-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.a9fbed030d-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.b785a22893-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.be40b79ac1-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.c1d056839c-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.c960d11f14-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.cd8234e68e-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.dc0161913b-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.e78565c854-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us11_f268b2f26e0ca5824aff057e5.fbd7c98f77-875ab38019@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.04419570b8-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.11b68f5acb-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.3c287aaa3d-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.3d803c9407-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.40ab532a2e-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.723c323ffb-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.73793111ab-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.874e247d2d-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.935fdc7ef7-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.99a88931f0-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.9a7c1d2de0-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.9e7565b6ad-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.9eff36db4b-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.ac9d721302-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.ae506a5422-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.b1d6909c2e-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.b494408a4e-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.ee2ac7f40d-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.f51191732a-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.f56cd80263-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_2768ea8e53da1b3ff17fb6a6f.fbeb2bb9d9-477e2b071c@mailin1.us2.mcsv.net
unsubscribe-mc.us2_713890abf2379a0ea65d2f132.3910348de4-ade51248f9@mailin1.us2.mcsv.net
unsubscribe-mc.us2_713890abf2379a0ea65d2f132.95694a2deb-ade51248f9@mailin1.us2.mcsv.net
unsubscribe-mc.us4_12c7cd9f433f9a73481efaa09.3f53d4707f-d31b5459a5@mailin1.us2.mcsv.net
unsubscribe-mc.us5_02e860b1027d7c0e3dbcbe0e6.9b4b56d6a8-03a763b7cb@mailin1.us2.mcsv.net
unsubscribe-mc.us5_02e860b1027d7c0e3dbcbe0e6.a14e709c42-03a763b7cb@mailin1.us2.mcsv.net
unsubscribe-mc.us5_02e860b1027d7c0e3dbcbe0e6.eb3d0e1bfe-03a763b7cb@mailin1.us2.mcsv.net
unsubscribe-mc.us5_02e860b1027d7c0e3dbcbe0e6.f4d1959237-03a763b7cb@mailin1.us2.mcsv.net
unsubscribe-mc.us5_c81203f475123a9e28e9c42cd.49e9d7246a-4c5c72a395@mailin1.us2.mcsv.net
unsubscribe-mc.us5_ef4b47224a729cbb02177c9b6.c2c175b06f-00467f9d3e@mailin1.us2.mcsv.net
unsubscribe-mc.us5_ef4b47224a729cbb02177c9b6.d623b9725c-00467f9d3e@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.0116099ca3-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.022d571481-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.04d2192574-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.0c010686b3-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.196bd3a570-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.20678b0ff6-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.25948c481f-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.32ac5d8400-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.3f80fb3686-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.440937f385-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.47437ed29d-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.4fbd223650-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.52031c80f2-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.5306cc69ec-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.540231f625-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.545c117251-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.54b019536d-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.5d885a509b-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.68c14638f0-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.7462783724-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.777149b9d6-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.79a1ef71ec-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.857dd3d904-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.89985ffb01-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.96c0479b56-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.9f854c9903-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.ac18a4b8a5-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.afe966e3d2-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.bee54be864-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.bfebd481e7-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.c0afdbaa12-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.c1ec098dfa-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.d2863943af-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.d70e749c88-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.e27f85c235-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.e594655c7d-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us7_232a4a45176fccacab865e520.eb40c0733c-a7f9100a75@mailin1.us2.mcsv.net
unsubscribe-mc.us8_36c48de8239770148b317d5a0.6e8d6a4967-fbd0ed098e@mailin1.us2.mcsv.net
unsubscribe-tjthhrt2otlyhykh2i-7cfda08b@cmail2.com
unsubscribe-tkyhlly2xdtludjy2i-795eb942@cmail2.com
unsubscribe-tlktlyd2otlyhykh2i-7cfda08b@cmail2.com
unsubscribe-ttddhhk2otlyhykh2i-7cfda08b@cmail2.com
unsubscribe-yqpglljhjltqgifl9in5d7qibwol5dmjafv1k51ybs5ypijo9zaczd6zc4wyrmpfpza@imh.rsys2.com
unsubscribe@googlegroups.com
unsubscribe@hillaryclinton.com
unsubscribe@knox.edu
unsubscribe@ndi.org
unsubscribe_20150624071716.4624471.430657@mx.sailthru.com
unsubscribe_20150625072946.4631940.426721@mx.sailthru.com
unsubscribe_20150626072444.4639182.424033@mx.sailthru.com
unsubscribe_20150709071246.4718719.386849@mx.sailthru.com
unsubscribe_20150720071138.4784549.332257@mx.sailthru.com
unsubscribe_20150721072059.4791911.330657@mx.sailthru.com
unsubscribe_20150729071648.4842561.307233@mx.sailthru.com
unsubscribe_20150805072001.4886738.299137@mx.sailthru.com
unsubscribe_20150806075420.4894602.298369@mx.sailthru.com
unsubscribe_20150811072955.4924029.294145@mx.sailthru.com
unsubscribe_20150812072600.4931428.291873@mx.sailthru.com
unsubscribe_20150814073514.4946064.284993@mx.sailthru.com
unsubscribe_20150817071001.4961437.282849@mx.sailthru.com
unsubscribe_20151103081752.5462024.164417@mx.sailthru.com
unsubscribe_20151105082501.5477074.155265@mx.sailthru.com
unsubscribe_20151106080858.5484308.154529@mx.sailthru.com
unsubscribe_20151110081249.5506351.152545@mx.sailthru.com
unsubscribe_20151112080446.5520593.148257@mx.sailthru.com
unsubscribe_20151115095332.5540341.127489@mx.sailthru.com
unsubscribe_20151124080743.5597577.123073@mx.sailthru.com
unsubscribe_20151125074529.5605712.122497@mx.sailthru.com
unsubscribe_20151204081337.5661224.119809@mx.sailthru.com
unsubscribe_20151209081020.5691551.484429@mx.sailthru.com
unsubscribe_20151215174835.5734855.481902@mx.sailthru.com
unsubscribe_20151221080922.5768622.478042@mx.sailthru.com
unsubscribe_20151223084132.5784671.475097@mx.sailthru.com
unsubscribe_20151224071711.5791415.471385@mx.sailthru.com
unsubscribe_20151228074826.5808849.467306@mx.sailthru.com
unsubscribe_20151230084640.5822715.463126@mx.sailthru.com
unsubscribe_20151230130731.5824278.116858@mx.sailthru.com
unsubscribe_20160107083246.5867926.459617@mx.sailthru.com
unsubscribe_20160126085731.5983511.427393@mx.sailthru.com
unsubscribe_20160214093804.6105674.402177@mx.sailthru.com
unsubscribe_20160221102113.6148827.390785@mx.sailthru.com
unsubscribe_20160229083256.6197556.381537@mx.sailthru.com
update@kslaw.com
update@kslawmail.com
ur@hillaryclinton.com
urrie@bsgco.com
us@wsj.com
usa0916@brooklapping.com
uwse56nn2jonq@mail.gmail.com
uyo5pknq0f8yed6dmz4o16fmtg6rpe3a-5oh_xw@mail.gmail.com
v-bfmnlil_bkaielapjd_cckladka_cckladka_a@bounce.hillaryclinton.com
v-lhnaje_cogmlpnabf_cdmgghkl_cdmgghkl_a@bounce.hks
v-lhnaje_cogmlpnabf_cdmgghkl_cdmgghkl_a@bounce.hks-belfercenter.mkt4851.com
v-lhpgao_cogmlpnabf_cdmhhogf_cdmhhogf_a@bounce.hks
v-lhpgao_cogmlpnabf_cdmhhogf_cdmhhogf_a@bounce.hks-belfercenter.mkt4851.com
v-licddm_cogmlpnabf_cdmilpjj_cdmilpjj_a@bounce.hks
v-licddm_cogmlpnabf_cdmilpjj_cdmilpjj_a@bounce.hks-belfercenter.mkt4851.com
v-ljcalp_cogmlpnabf_cdnbklao_cdnbklao_a@bounce.hks
v-ljcalp_cogmlpnabf_cdnbklao_cdnbklao_a@bounce.hks-belfercenter.mkt4851.com
v-lmljca_cogmlpnabf_ceppikbf_ceppikbf_a@bounce.hks
v-lmljca_cogmlpnabf_ceppikbf_ceppikbf_a@bounce.hks-belfercenter.mkt4851.com
v-maaoal_cogmlpnabf_cgcknjfm_cgcknjfm_a@bounce.hks-belfercenter.mkt4851.com
v-mgenhi_cogmlpnabf_chgkdpok_chgkdpok_a@bounce.hks-belfercenter.mkt4851.com
v-mieadb_cogmlpnabf_ciikhjhl_ciikhjhl_a@bounce.hks-belfercenter.mkt4851.com
v-mlbbik_cogmlpnabf_cikbjgdh_cikbjgdh_a@bounce.hks-belfercenter.mkt4851.com
v-moieca_cogmlpnabf_cjmpaemi_cjmpaemi_a@bounce.hks-belfercenter.mkt4851.com
v-mpgcne_cogmlpnabf_cjngkmmm_cjngkmmm_a@bounce.hks-belfercenter.mkt4851.com
v-neheba_cogmlpnabf_cmcfgadg_cmcfgadg_a@bounce.hks-belfercenter.mkt4851.com
v13qyvrhv3ie8zo05jakg@mail.gmail.com
valexander@clintonfoundation.org
van@gmail.com
van@hillaryclinton.com
vanand@hillaryclinton.com
vandana@vandanashiva.com
vbjorklund@stblaw.com
vck+9en-eoqjmoc5rqfhva@mail.gmail.com
vd2ee_a1tajnyqhfnfgg_xoywftywv+m0+d3yn-pg8q@mail.gmail.com
vel@americanprogress.org
vergun@alumni.st
vergun@alumni.stanford.edu
vermarr@state.gov
veronica.pollock@dlapiper.com
veronica@daschlegroup.com
vfazio@akingump.com
vid@dixondavismedia.com
viejojoe1@cox.net
viejojoe@outlook.com
virtualwar-room@googlegroups.com
vitz@greenamerica.org
vivian@democracyinamericas.org
vjarrett@barackobama.com
vjarrett@habitat.com
vlb4qjzixvuhubsjb+ee-i+vsqf64icmx3yka@mail.gmail.com
vnzdq4brwgagciw@mail.gmail.com
vote@jenniferpae.com
vsingh@americanprogress.org
vtckjgq2mg@mail.gmail.com
w762smcsza@mail.gmail.com
w@hillaryclinton.com
wabrams1@me.com
wallacep333@gmail.com
wamonews@washingtonmonthly.ccsend.com
wantholis@brookings.edu
watkins.sarah.e@gmail.com
wbp8f28sdfwucghc-h_jnvd67q@mail.gmail.com
wbugnon@nrdc.org
wcp9@georgetown.edu
wcusyl5ftyds9bbtyrrhqpa@mail.gmail.com
weiland@pmidpi.com
weiner@americansunitedforchange.org
wen@gmail.com
wendyrsherman@gmail.com
werin@gmail.com
werin@hillaryclinton.com
werin@hrcoffice.com
whitney@huffingtonpost.com
will@thewaronbugsbook.com
william.m.daley@jpmchase.com
williamsbarrett@aol.com
wjperry@aol.com
wmjglqt-5reamdjvcopmyfgh86mn5ehp7f+-dg@mail.gmail.com
wmorris@clintonfoundation.org
ws@jacompany.com
wwf6ip0gkb0cw@mail.gmail.com
wwics@wilsoncenter.org
wxta8i0rc8m33r3hoyn8zovqwymzg@mail.gmail.com
wyndee.parker@mail.house.gov
wznsacjzydw3u7knhyahg9mulg@mail.gmail.com
x.ma1.1438368262@aol.com
x77q7vj_maxa0vomgahrkp9bhbaa@mail.gmail.com
xbj0yjip66khdm9fdgq@mail.gmail.com
xcbhn7nf+jd-ch5z39sxojqz5idwvxmzgfhyyuhp4q2yycw@mail.gmail.com
xfzs7j-xtunuy5n1d315xvt0vdid49bw7ua@mail.gmail.com
xiw3v6oqc6q5s-rbei0ovqgqa@mail.gmail.com
xjih5ukacwm_vuw@mail.gmail.com
xpnsbrjbt7+hbg@mail.gmail.com
xsnxc-kszesh2ugievf_yyex9fmh1iym5w@mail.gmail.com
y.carrk@gmail.com
y2hi10fst6ipnq7a@mail.gmail.com
y3@gmail.com
y@google.com
y@hrcoffice.com
yak@hillaryclinton.com
yaxjn8+uy29vbsymbmomzsaeq2uhj1zydcagw@mail.gmail.com
yb07r2r8itqupyfdq1tdvqm7k9sskbhrfd4ng@mail.gmail.com
yellow-sml@2x.png
yg@mail.gmail.com
yh-x8gqrinnbb0miq6wcpyowhgxtqh1p9zrhyrfi8ppweq@mail.gmail.com
yh8kofo6kxajz2jrgxwi0rsvmovqm-ef6et2fqvpeqqnmq@mail.gmail.com
yh94mjoim-gegscqo5uu1vsjtg0trgu+cbmms9efpea8iq@mail.gmail.com
yh_50mrpg0ahfz1hhtj3xouyqi_ygomh7tgudou3uksxeg@mail.gmail.com
yhg@mail.gmail.com
ymook2015@gmail.com
yn.sepp@gmail.com
yriinvvqxbqoddhjufkepm6yu_uma@mail.gmail.com
z00uboqdnpufqhdgxvunn6bkzkqpq9rhl6g73px84q@mail.gmail.com
z@greenamerica.org
za@mail.gmail.com
zachary.kaufman@aya.yale.edu
zc9n5ke1bvwrgqnsjt3a@mail.gmail.com
zenstat@cov.com
zer@wholefoods.com
zk1p+k9ytqzjc8etqunzee8w@mail.gmail.com
zkw1hjqbgubg@mail.gmail.com
znd2cjwhbk1zkebp6jdrsdq@mail.gmail.com
zpetkanas@hillaryclinton.com
zschwartz@shangrila.us
zshaikley@clintonfoundation.or
zshaikley@clintonfoundation.org
zuufkqki3vufddy-4fq-8v-81_r9zq2tw@mail.gmail.com
zvch4yn-_gcqzuuqosx7fji327mqt-ju2msq@mail.gmail.com
zwright@hillaryclinton.com
zya@mail.gmail.com

Posted in Podesta.

Leave a Reply